Recombinant Human IL32 Protein, GST-tagged
Cat.No. : | IL32-5189H |
Product Overview : | Human IL32 full-length ORF ( NP_001012649.1, 1 a.a. - 188 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the cytokine family. The protein contains a tyrosine sulfation site, 3 potential N-myristoylation sites, multiple putative phosphorylation sites, and an RGD cell-attachment sequence. Expression of this protein is increased after the activation of T-cells by mitogens or the activation of NK cells by IL-2. This protein induces the production of TNFalpha from macrophage cells. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq |
Molecular Mass : | 48.1 kDa |
AA Sequence : | MCFPKVLSDDMKKLKARMHQAIERFYDKMQNAESGRGQVMSSLAELEDDFKEGYLETVAAYYEEQHPELTPLLEKERDGLRCRGNRSPVPDVEDPATEEPGESFCDKVMRWFQAMLQRLQTWWHGVLAWVKEKVVALVHAVQALWKQFQSFCCSLSELFMSSFQSYGAPRGDKEELTPQKCSEPQSSK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | IL32 interleukin 32 [ Homo sapiens ] |
Official Symbol | IL32 |
Synonyms | IL32; interleukin 32; interleukin-32; natural killer cell transcript 4; NK4; TAIF; TAIFb; TAIFd; interleukin-32 eta; interleukin-32 small; interleukin-32 theta; natural killer cells protein 4; tumor necrosis factor alpha-inducing factor; TAIFa; TAIFc; IL-32beta; IL-32alpha; IL-32delta; IL-32gamma; |
Gene ID | 9235 |
mRNA Refseq | NM_001012631 |
Protein Refseq | NP_001012649 |
MIM | 606001 |
UniProt ID | P24001 |
◆ Recombinant Proteins | ||
IL32-2627H | Recombinant Human IL32 Protein (Ala31-Lys234), N-His tagged | +Inquiry |
IL32-156H | Recombinant Human IL32 protein(Met1-Lys131), His-tagged | +Inquiry |
IL32-151H | Recombinant Human IL32 Protein, His-tagged | +Inquiry |
IL32-5300H | Recombinant Human IL32 Protein (Met1-Lys234), C-His tagged | +Inquiry |
IL32-6150H | Recombinant Human IL32 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL32-2743HCL | Recombinant Human IL32 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL32 Products
Required fields are marked with *
My Review for All IL32 Products
Required fields are marked with *