Recombinant Human IL5 protein, His-tagged
Cat.No. : | IL5-126H |
Product Overview : | Recombinant Human IL5(Ile20-Ser134) fused with His tag at C-terminal was expressed in HEK293. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | Ile20-Ser134 |
Description : | IL-5 is expressed in eosinophils, NK cells, TC2 CD8+ T cells, mast cells, CD45+ CD4+ T cells, gamma delta T cells and IL-1 beta activated endothelial cells. IL-5 acts as a growth and differentiation factor for both B cells and eosinophils. Relative to B cells, IL-5 appears to induce the differentiation of activated conventional B-2 cells into Ig-secreting cells. In addition, it induces the growth of B-1 progenitors as well as IgM production by B-1 cells.IL-5 appears to perform a number of functions on eosinophils. These include the down modulation of Mac-1,the upregulation of receptors for IgA and IgG,the stimulation of lipid mediator (leukotriene C4 and PAF) secretion and the induction of granule release.IL-5 also promotes the growth and differentiation of eosinophils. |
Form : | Lyophilized from a 0.2 μm filtered solution of PBS,pH7.4. |
AA Sequence : | IPTEIPTSALVKETLALLSTHRTLLIANETLRIPVPVHKNHQLCTEEIFQGIGTLESQTVQGGTV ERLFKNLSLIKKYIDGQKKKCGEERRRVNQFLDYLQEFLGVMNTEWIIESVDHHHHHH |
Endotoxin : | Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test. |
Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
Storage : | Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days. Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months. |
Reconstitution : | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Shipping : | The product is shipped at ambient temperature. |
Gene Name | IL5 interleukin 5 (colony-stimulating factor, eosinophil) [ Homo sapiens ] |
Official Symbol | IL5 |
Synonyms | IL5; interleukin 5 (colony-stimulating factor, eosinophil); interleukin-5; B cell differentiation factor I; EDF; eosinophil differentiation factor; IL 5; interleukin 5; T cell replacing factor; TRF; T-cell replacing factor; B-cell differentiation factor I; IL-5; |
Gene ID | 3567 |
mRNA Refseq | NM_000879 |
Protein Refseq | NP_000870 |
MIM | 147850 |
UniProt ID | P05113 |
Chromosome Location | 5q23-q31 |
Pathway | Allograft rejection, organism-specific biosystem; Allograft rejection, conserved biosystem; Asthma, organism-specific biosystem; Asthma, conserved biosystem; Autoimmune thyroid disease, organism-specific biosystem; Autoimmune thyroid disease, conserved biosystem; Calcineurin-regulated NFAT-dependent transcription in lymphocytes, organism-specific biosystem; |
Function | cytokine activity; growth factor activity; interleukin-5 receptor binding; protein binding; |
◆ Recombinant Proteins | ||
Il5-207M | Recombinant Active Mouse IL5 Protein, His-tagged(C-ter) | +Inquiry |
Il5-206M | Recombinant Mouse Il5 protein | +Inquiry |
IL5-183M | Active Recombinant Mouse IL5 Protein | +Inquiry |
Il5-755M | Recombinant Mouse Il5 protein(Met1-Gly133), His-tagged | +Inquiry |
Il5-07M | Active Recombinant Mouse Il5 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL5-496MCL | Recombinant Mouse IL5 cell lysate | +Inquiry |
IL5-456CCL | Recombinant Canine IL5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL5 Products
Required fields are marked with *
My Review for All IL5 Products
Required fields are marked with *
0
Inquiry Basket