"IL7" Related Products

Expand
Expand

Recombinant Human IL7 Protein, GST-tagged

Cat.No. : IL7-5170H
Product Overview : Human IL7 full-length ORF ( AAH47698, 26 a.a. - 177 a.a.) recombinant protein with GST-tag at N-terminal.
Description : The protein encoded by this gene is a cytokine important for B and T cell development. This cytokine and the hepatocyte growth factor (HGF) form a heterodimer that functions as a pre-pro-B cell growth-stimulating factor. This cytokine is found to be a cofactor for V(D)J rearrangement of the T cell receptor beta (TCRB) during early T cell development. This cytokine can be produced locally by intestinal epithelial and epithelial goblet cells, and may serve as a regulatory factor for intestinal mucosal lymphocytes. Knockout studies in mice suggested that this cytokine plays an essential role in lymphoid cell survival. [provided by RefSeq
Source : Wheat Germ
Species : Human
Tag : GST
Molecular Mass : 42.46 kDa
AA Sequence : DCDIEGKDGKQYESVLVVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name : IL7 interleukin 7 [ Homo sapiens ]
Official Symbol : IL7
Synonyms : IL7; interleukin 7; interleukin-7; IL 7; IL-7;
Gene ID : 3574
mRNA Refseq : NM_000880
Protein Refseq : NP_000871
MIM : 146660
UniProt ID : P13232

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.