Recombinant Human Interleukin 33

Cat.No. : IL33-58H
Product Overview : Recombinant Human Interleukin33 produced inE.Coliis a single, non-glycosylated, polypeptide chain containing 160 amino acids and having a molecular mass of 18 kDa. The IL-33 is purified by proprietary chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Description : Interleukin 33 (IL-33) is a 32kDa proinflammatory cytokine that may also regulate gene transcription in producer cells. IL-33 is structurally related to IL-1, which induces helper T cells to produce type 2 cytokines and acts through the receptor IL1RL-1 (IL1 receptor-like-1), which is known also as ST2. Binding of IL-33 to this receptor activates NF-kappa-B and MAP kinases and induces in vitro Th2 cells to produce cytokines. In vivo, IL-33 induces expression of IL-4, IL-5, IL-13 and leads to severe pathological changes in mucosal organs and in vitro, it can be divided to N-terminal fragment of 12kDa and C-terminal fragment of 18kDa by cleavage of caspase-1.
Amino Acid Sequence : MSITGISPITEYL ASLSTYNDQSIT FALEDESYEIYV EDLKKDEKKD KVLLSYYESQH PSNESGDGVDGKMLMVTLSPTKDFWLHANNKEHSVELHKCEKPLPDQAFFVLHNM HSNCVSF EC KTDPGVFIGVKDNHLALI KVDSSENLCT ENILFKLSET.
Physical Appearance : Sterile Filtered colorless liquid at a concentration of 1 mg/ml.
Purity : Greater than 95.0% as determined by: (a) Analysis by RP-HPLC. (b) Analysis by SDS-PAGE.
Formulation : The protein is formulated in 20mM Tris pH-8.
Biological Activity : The ED50 as determined by the dose-dependant stimulation of TF-1 cells is < 0.1 ng/ml, corresponding to a Specific Activity of 1 x 107IU/mg.
Storage : IL-33 although stable at 14°Cfor 1 week, should be stored desiccated below -18°C. Upon arrival IL33 Recombinant should be stored at 4°Cbetween 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Gene Name IL33 interleukin 33 [ Homo sapiens ]
Synonyms IL33; interleukin 33; DVS27; NF-HEV; NFEHEV; C9orf26; DKFZp586H0523; RP11-575C20.2; DVS27-related protein; nuclear factor from high endothelial venules; chromosome 9 open reading frame 26 (NF-HEV); IL-1F11; IL-33; IL1F11; NFHEV; OTTHUMP00000021041; Interleukin-1 family member 11; Nuclear factor from high endothelial venules
Gene ID 90865
mRNA Refseq NM_033439
Protein Refseq NP_254274
MIM 608678
UniProt ID O95760
Chromosome Location 9p24.1
Function cytokine activity; protein binding

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL33 Products

Required fields are marked with *

My Review for All IL33 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon