Recombinant Human IRF1 Protein, GST-tagged
Cat.No. : | IRF1-5046H |
Product Overview : | Human IRF1 full-length ORF ( NP_002189.1, 1 a.a. - 325 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | IRF1 encodes interferon regulatory factor 1, a member of the interferon regulatory transcription factor (IRF) family. IRF1 serves as an activator of interferons alpha and beta transcription, and in mouse it has been shown to be required for double-stranded RNA induction of these genes. IRF1 also functions as a transcription activator of genes induced by interferons alpha, beta, and gamma. Further, IRF1 has been shown to play roles in regulating apoptosis and tumor-suppressoion. [provided by RefSeq |
Molecular Mass : | 61.38 kDa |
AA Sequence : | MPITRMRMRPWLEMQINSNQIPGLIWINKEEMIFQIPWKHAAKHGWDINKDACLFRSWAIHTGRYKAGEKEPDPKTWKANFRCAMNSLPDIEEVKDQSRNKGSSAVRVYRMLPPLTKNQRKERKSKSSRDAKSKAKRKSCGDSSPDTFSDGLSSSTLPDDHSSYTVPGYMQDLEVEQALTPALSPCAVSSTLPDWHIPVEVVPDSTSDLYNFQVSPMPSTSEATTDEDEEGKLPEDIMKLLEQSEWQPTNVDGKGYLLNEPGVQPTSVYGDFSCKEEPEIDSPGGDIGLSLQRVFTDLKNMDATWLDSLLTPVRLPSIQAIPCAP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | IRF1 interferon regulatory factor 1 [ Homo sapiens ] |
Official Symbol | IRF1 |
Synonyms | IRF1; interferon regulatory factor 1; MAR; IRF-1; |
Gene ID | 3659 |
mRNA Refseq | NM_002198 |
Protein Refseq | NP_002189 |
MIM | 147575 |
UniProt ID | P10914 |
◆ Recombinant Proteins | ||
IRF1-1133H | Recombinant Human IRF1 protein, His&Myc-tagged | +Inquiry |
IRF1-5735HF | Recombinant Full Length Human IRF1 Protein, GST-tagged | +Inquiry |
IRF1-3118H | Recombinant Human IRF1 Protein (Trp11-Glu276), N-His tagged | +Inquiry |
IRF1-1833H | Recombinant Human IRF1 protein(1-325aa), His&Myc-tagged | +Inquiry |
IRF1-3169H | Recombinant Human IRF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IRF1-5168HCL | Recombinant Human IRF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IRF1 Products
Required fields are marked with *
My Review for All IRF1 Products
Required fields are marked with *
0
Inquiry Basket