Recombinant Human IRF2 Protein, GST-tagged
Cat.No. : | IRF2-5044H |
Product Overview : | Human IRF2 full-length ORF ( AAH15803.1, 1 a.a. - 349 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | IRF2 encodes interferon regulatory factor 2, a member of the interferon regulatory transcription factor (IRF) family. IRF2 competitively inhibits the IRF1-mediated transcriptional activation of interferons alpha and beta, and presumably other genes that employ IRF1 for transcription activation. However, IRF2 also functions as a transcriptional activator of histone H4. [provided by RefSeq |
Molecular Mass : | 65.8 kDa |
AA Sequence : | MPVERMRMRPWLEEQINSNTIPGLKWLNKEKKIFQIPWMHAARHGWDVEKDAPLFRNWAIHTGKHQPGVDKPDPKTWKANFRCAMNSLPDIEEVKDKSIKKGNNAFRVYRMLPLSERPSKKGKKPKTEKEDKVKHIKQEPVESSLGLSNGVSDLSPEYAVLTSTIKNEVDSTVNIIVVGQSHLDSNIENQEIVTNPPDICQVVEVTTESDEQPVSMSELYPLQISPVSSYAESETTDSVPSDEESAEGRPHWRKRNIEGKQYLSNMGTRGSYLLPGMASFVTSNKPDLQVTIKEESNPVPYNSSWPPFQDLPLSSSMTPASSSSRPDRETRASVIKKTSDITQARVKSC |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | IRF2 interferon regulatory factor 2 [ Homo sapiens ] |
Official Symbol | IRF2 |
Synonyms | IRF2; interferon regulatory factor 2; IRF-2; DKFZp686F0244; |
Gene ID | 3660 |
mRNA Refseq | NM_002199 |
Protein Refseq | NP_002190 |
MIM | 147576 |
UniProt ID | P14316 |
◆ Recombinant Proteins | ||
IRF2-8297M | Recombinant Mouse IRF2 Protein | +Inquiry |
IRF2-6750C | Recombinant Chicken IRF2 | +Inquiry |
IRF2-28272TH | Recombinant Human IRF2, His-tagged | +Inquiry |
Irf2-378M | Recombinant Mouse Irf2 Protein, His-tagged | +Inquiry |
IRF2-725H | Recombinant Human IRF2 Protein, DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IRF2-5167HCL | Recombinant Human IRF2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IRF2 Products
Required fields are marked with *
My Review for All IRF2 Products
Required fields are marked with *