Recombinant Human ITGAM, GST-tagged

Cat.No. : ITGAM-231H
Product Overview : Recombinant Human ITGAM(111 a.a. - 220 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes the integrin alpha M chain. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. This I-domain containing alpha integrin combines with the beta 2 chain (ITGB2) to form a leukocyte-specific integrin referred to as macrophage receptor 1 ('Mac-1'), or inactivated-C3b (iC3b) receptor 3 ('CR3'). The alpha M beta 2 integrin is important in the adherence of neutrophils and monocytes to stimulated endothelium, and also in the phagocytosis of complement coated particles. Multiple transcript variants encoding different isoforms have been found for this gene.
Molecular Mass : 37.84 kDa
AA Sequence : QTCSENTYVKGLCFLFGSNLRQQPQKFPEALRGCPQEDSDIAFLIDGSGSIIPHDFRRMKEFVSTVMEQLKKSKT LFSLMQYSEEFRIHFTFKEFQNNPNPRSLVKPITQ
Applications : ELISA; WB-Re; AP; Array
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name ITGAM integrin, alpha M (complement component 3 receptor 3 subunit) [ Homo sapiens (human) ]
Official Symbol ITGAM
Synonyms ITGAM; CR3A; MO1A; CD11B; MAC-1; MAC1A; SLEB6; integrin, alpha M (complement component 3 receptor 3 subunit); integrin alpha-M; CR-3 alpha chain; antigen CD11b (p170); leukocyte adhesion receptor MO1; CD11 antigen-like family member B; macrophage antigen alpha polypeptide; cell surface glycoprotein MAC-1 subunit alpha; neutrophil adherence receptor alpha-M subunit
Gene ID 3684
mRNA Refseq NM_000632
Protein Refseq NP_000623
MIM 120980
UniProt ID P11215
Chromosome Location 16p11.2
Pathway Cell adhesion molecules (CAMs); Focal Adhesion; IL-5 Signaling Pathway
Function glycoprotein binding; heparan sulfate proteoglycan binding; heparin binding

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ITGAM Products

Required fields are marked with *

My Review for All ITGAM Products

Required fields are marked with *

0

Inquiry Basket

cartIcon