Recombinant Human ITGAM, GST-tagged
Cat.No. : | ITGAM-231H |
Product Overview : | Recombinant Human ITGAM(111 a.a. - 220 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes the integrin alpha M chain. Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. This I-domain containing alpha integrin combines with the beta 2 chain (ITGB2) to form a leukocyte-specific integrin referred to as macrophage receptor 1 ('Mac-1'), or inactivated-C3b (iC3b) receptor 3 ('CR3'). The alpha M beta 2 integrin is important in the adherence of neutrophils and monocytes to stimulated endothelium, and also in the phagocytosis of complement coated particles. Multiple transcript variants encoding different isoforms have been found for this gene. |
Molecular Mass : | 37.84 kDa |
AA Sequence : | QTCSENTYVKGLCFLFGSNLRQQPQKFPEALRGCPQEDSDIAFLIDGSGSIIPHDFRRMKEFVSTVMEQLKKSKT LFSLMQYSEEFRIHFTFKEFQNNPNPRSLVKPITQ |
Applications : | ELISA; WB-Re; AP; Array |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | ITGAM integrin, alpha M (complement component 3 receptor 3 subunit) [ Homo sapiens (human) ] |
Official Symbol | ITGAM |
Synonyms | ITGAM; CR3A; MO1A; CD11B; MAC-1; MAC1A; SLEB6; integrin, alpha M (complement component 3 receptor 3 subunit); integrin alpha-M; CR-3 alpha chain; antigen CD11b (p170); leukocyte adhesion receptor MO1; CD11 antigen-like family member B; macrophage antigen alpha polypeptide; cell surface glycoprotein MAC-1 subunit alpha; neutrophil adherence receptor alpha-M subunit |
Gene ID | 3684 |
mRNA Refseq | NM_000632 |
Protein Refseq | NP_000623 |
MIM | 120980 |
UniProt ID | P11215 |
Chromosome Location | 16p11.2 |
Pathway | Cell adhesion molecules (CAMs); Focal Adhesion; IL-5 Signaling Pathway |
Function | glycoprotein binding; heparan sulfate proteoglycan binding; heparin binding |
◆ Recombinant Proteins | ||
ITGAM-432H | Recombinant Human ITGAM protein, His-GST-tagged | +Inquiry |
ITGAM-737HFL | Recombinant Full Length Human ITGAM Protein, C-Flag-tagged | +Inquiry |
ITGAM-231H | Recombinant Human ITGAM, GST-tagged | +Inquiry |
ITGAM-1065H | Recombinant Human ITGAM Protein, His-tagged | +Inquiry |
Itgam-1801R | Recombinant Rat Itgam protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ITGAM Products
Required fields are marked with *
My Review for All ITGAM Products
Required fields are marked with *
0
Inquiry Basket