Recombinant Human KITLG, StrepII-tagged
Cat.No. : | KITLG-262H |
Product Overview : | Purified, full-length human recombinant KITLG or Kit ligand protein (amino acids 26-279, 254 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 18.5 kDa. (Accession NP_000890.1; UniProt P21583) |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Strep II |
Protein Length : | 26-279, 254 a.a. |
Description : | KITLG is the ligand of the tyrosine-kinase receptor encoded by the KIT. This ligand is a pleiotropic factor that acts in utero in germ cell and neural cell development, and hematopoiesis, all believed to reflect a role in cell migration. In adults, it functions pleiotropically, while mostly noted for its continued requirement in hematopoiesis. |
Form : | Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free). |
AA Sequence : | EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDL KKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVAA |
Endotoxin : | <0.1 eu per ug protein by lal |
Purity : | >95% pure by SDS-PAGE |
Storage : | 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles. |
Reconstitution : | Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml. |
Gene Name | KITLG KIT ligand [ Homo sapiens ] |
Official Symbol | KITLG |
Synonyms | KITLG; KIT ligand; MGF; kit ligand; familial progressive hyperpigmentation 2; FPH2; Kitl; KL 1; mast cell growth factor; SCF; SF; steel factor; stem cell factor; c-Kit ligand; KL-1; SHEP7; kit-ligand; DKFZp686F2250; |
Gene ID | 4254 |
mRNA Refseq | NM_000899 |
Protein Refseq | NP_000890 |
MIM | 184745 |
UniProt ID | P21583 |
Chromosome Location | 12q22 |
Pathway | C-MYB transcription factor network, organism-specific biosystem; Cytokine-cytokine receptor interaction, organism-specific biosystem; Cytokine-cytokine receptor interaction, conserved biosystem; Hematopoietic cell lineage, organism-specific biosystem; Hematopoietic cell lineage, conserved biosystem; Kit Receptor Signaling Pathway, organism-specific biosystem; Melanogenesis, organism-specific biosystem; |
Function | cytokine activity; growth factor activity; protein binding; stem cell factor receptor binding; |
◆ Recombinant Proteins | ||
Kitlg-62R | Recombinant Rat Kit Ligand | +Inquiry |
KITLG-2584H | Recombinant Human KITLG Protein (Glu26-His214), C-His tagged | +Inquiry |
KITLG-141H | Active Recombinant Human KITLG Protein | +Inquiry |
Kitlg-5267R | Recombinant Rat KIT Ligand | +Inquiry |
KITLG-2585H | Recombinant Human KITLG Protein (Glu26-Ala189), N-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KITLG-583MCL | Recombinant Mouse KITLG cell lysate | +Inquiry |
KITLG-571HCL | Recombinant Human KITLG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KITLG Products
Required fields are marked with *
My Review for All KITLG Products
Required fields are marked with *
0
Inquiry Basket