Active Recombinant Human KITLG Protein
Cat.No. : | KITLG-141H |
Product Overview : | Recombinant Human Stem Cell Factor is produced by our E.coli expression system and the target gene encoding Glu26-Ala189 is expressed. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | Glu26-Ala189 |
Description : | Stem Cell Factor (SCF) is a hematopoietic growth factor that exerts its activity at the early stages of hematopoiesis. SCF stimulates the proliferation of myeloid, erythroid, and lymphoid progenitors in bone marrow cultures and has been shown to act synergistically with colony stimulating factors. |
Form : | Lyophilized from a 0.2 um filtered solution of 20mM PB, 150mM NaCl, pH 7.0. |
Bio-activity : | Measured by the dose-dependent stimulation of Human TF-1 cells. ED50 is less than 2 ng/ml. Specific Activity of 5.0 x 10^5 IU/mg. |
AA Sequence : | MEGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNIS EGLSNYSIIDKLVNIVD DLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRV SVTKPFMLPPVA |
Endotoxin : | Less than 0.1 ng/ug (1 EU/ug). |
Purity : | >95% |
Storage : | Lyophilized protein should be stored at < -20 centigrade, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7 centigrade for 2-7 days. Aliquots of reconstituted samples are stable at < -20 centigrade for 3 months. |
Quality Statement : | Purity: Greater than 95% as determined by reducing SDS-PAGE. |
Shipping : | The product is shipped at ambient temperature. Upon receipt, store it immediately at the temperature listed below. |
Gene Name | KITLG KIT ligand [ Homo sapiens (human) ] |
Official Symbol | KITLG |
Synonyms | Kit Ligand; Mast Cell Growth Factor; MGF; Stem Cell Factor; c-Kit ligand; SCF; SF; MGF; SLF; DCUA; FPH2; FPHH; KL-1; Kitl; WS2F; SHEP7; DFNA69 |
Gene ID | 4254 |
mRNA Refseq | NM_000899.5 |
Protein Refseq | NP_000890.1 |
MIM | 184745 |
UniProt ID | P21583 |
◆ Recombinant Proteins | ||
KITLG-2584H | Recombinant Human KITLG Protein (Glu26-His214), C-His tagged | +Inquiry |
Kitl-576M | Active Recombinant Mouse Kitl protein, His-tagged | +Inquiry |
Kitl-3697M | Active Recombinant Mouse Kitl Protein | +Inquiry |
Kitlg-62R | Recombinant Rat Kit Ligand | +Inquiry |
KITLG-199H | Active Recombinant Human KITLG Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
KITLG-571HCL | Recombinant Human KITLG cell lysate | +Inquiry |
KITLG-583MCL | Recombinant Mouse KITLG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KITLG Products
Required fields are marked with *
My Review for All KITLG Products
Required fields are marked with *