Recombinant Human KLK8 Protein, GST-tagged

Cat.No. : KLK8-4928H
Product Overview : Human KLK8 full-length ORF ( NP_009127.1, 1 a.a. - 260 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in a cluster on chromosome 19. Alternate splicing of this gene results in four transcript variants encoding four different isoforms. The isoforms exhibit distinct patterns of expression that suggest roles in brain plasticity and ovarian cancer. [provided by RefSeq
Molecular Mass : 54.4 kDa
AA Sequence : MGRPRPRAAKTWMFLLLLGGAWAGHSRAQEDKVLGGHECQPHSQPWQAALFQGQQLLCGGVLVGGNWVLTAAHCKKPKYTVRLGDHSLQNKDGPEQEIPVVQSIPHPCYNSSDVEDHNHDLMLLQLRDQASLGSKVKPISLADHCTQPGQKCTVSGWGTVTSPRENFPDTLNCAEVKIFPQKKCEDAYPGQITDGMVCAGSSKGADTCQGDSGGPLVCDGALQGITSWGSDPCGRSDKPGVYTNICRYLDWIKKIIGSKG
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name KLK8 kallikrein-related peptidase 8 [ Homo sapiens ]
Official Symbol KLK8
Synonyms KLK8; kallikrein-related peptidase 8; kallikrein 8 (neuropsin/ovasin) , PRSS19; kallikrein-8; HNP; neuropsin; ovasin; TADG14; hK8; neuropsin type 1; neuropsin type 2; serine protease 19; KLK8 protein type 1; KLK8 protein type 2; serine protease TADG-14; tumor-associated differentially expressed gene 14 protein; NP; NRPN; PRSS19;
Gene ID 11202
mRNA Refseq NM_007196
Protein Refseq NP_009127
MIM 605644
UniProt ID O60259

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KLK8 Products

Required fields are marked with *

My Review for All KLK8 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon