Recombinant Mouse Klk8 protein, His-tagged

Cat.No. : Klk8-4518M
Product Overview : Recombinant Mouse Klk8 protein(Q61955)(33-260aa), fused to N-terminal His tag, was expressed in E. coli
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : His
Protein Length : 33-260aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 29.1 kDa
AA Sequence : ILEGRECIPHSQPWQAALFQGERLICGGVLVGDRWVLTAAHCKKQKYSVRLGDHSLQSRDQPEQEIQVAQSIQHPCYNNSNPEDHSHDIMLIRLQNSANLGDKVKPVQLANLCPKVGQKCIISGWGTVTSPQENFPNTLNCAEVKIYSQNKCERAYPGKITEGMVCAGSSNGADTCQGDSGGPLVCDGMLQGITSWGSDPCGKPEKPGVYTKICRYTTWIKKTMDNRD
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%.
Gene Name Klk8 kallikrein related-peptidase 8 [ Mus musculus ]
Official Symbol Klk8
Synonyms KLK8; kallikrein related-peptidase 8; kallikrein-8; NP; mK8; neuropsin; kallikrein 8; serine protease 19; Brain Serine protease 1; protease, serine, 19 (neuropsin); BSP1; Nrpn; Prss19;
Gene ID 259277
mRNA Refseq NM_008940
Protein Refseq NP_032966

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Klk8 Products

Required fields are marked with *

My Review for All Klk8 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon