Recombinant Mouse Klk8 protein, His-tagged
| Cat.No. : | Klk8-4518M |
| Product Overview : | Recombinant Mouse Klk8 protein(Q61955)(33-260aa), fused to N-terminal His tag, was expressed in E. coli |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 33-260aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 29.1 kDa |
| AA Sequence : | ILEGRECIPHSQPWQAALFQGERLICGGVLVGDRWVLTAAHCKKQKYSVRLGDHSLQSRDQPEQEIQVAQSIQHPCYNNSNPEDHSHDIMLIRLQNSANLGDKVKPVQLANLCPKVGQKCIISGWGTVTSPQENFPNTLNCAEVKIYSQNKCERAYPGKITEGMVCAGSSNGADTCQGDSGGPLVCDGMLQGITSWGSDPCGKPEKPGVYTKICRYTTWIKKTMDNRD |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | Klk8 kallikrein related-peptidase 8 [ Mus musculus ] |
| Official Symbol | Klk8 |
| Synonyms | KLK8; kallikrein related-peptidase 8; kallikrein-8; NP; mK8; neuropsin; kallikrein 8; serine protease 19; Brain Serine protease 1; protease, serine, 19 (neuropsin); BSP1; Nrpn; Prss19; |
| Gene ID | 259277 |
| mRNA Refseq | NM_008940 |
| Protein Refseq | NP_032966 |
| ◆ Recombinant Proteins | ||
| Klk8-4518M | Recombinant Mouse Klk8 protein, His-tagged | +Inquiry |
| KLK8-797H | Recombinant Human KLK8 protein, His & T7-tagged | +Inquiry |
| KLK8-688H | Recombinant Human KLK8 Protein, MYC/DDK-tagged | +Inquiry |
| KLK8-998H | Active Recombinant Human KLK8 Protein, His-tagged | +Inquiry |
| KLK8-4881M | Recombinant Mouse KLK8 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| KLK8-1985HCL | Recombinant Human KLK8 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Klk8 Products
Required fields are marked with *
My Review for All Klk8 Products
Required fields are marked with *
