Recombinant Human KLRD1 Protein, His-tagged
Cat.No. : | KLRD1-089H |
Product Overview : | Recombinant Human KLRD1 Protein with His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Description : | The activity of natural killer (NK) cells is regulated by members of multiple receptor families that recognize class I MHC molecules, such as the killer cell inhibitory receptor/leukocyte immunoglobulin-like receptor (KIR/LIR) family and the C-type lectin superfamily. The KIR/LIR family includes p91A (also designated pp130 or PIR-B, for paired immunoglobulin-like receptor-B) and p91B (also designated PIR-A). p91A acts as an inhibitory receptor through interactions with SHP-1, whereas p91B acts as an activating receptor. CD94, NKG2 and Ly-49 are members of the C-type lectin superfamily of type II membrane glycoproteins. CD94 forms heterodimers with NKG2 isoforms on the surface of NK cells, whereas Ly-49 isoforms form homodimers. NKG2-D, expressed on NK cells, γδ T cells, and CD8+ αβ T cells, is a receptor for the stress inducible protein MICA, an antigen frequently expressed in epithelial tumors. |
Molecular Mass : | ~19 kDa |
AA Sequence : | KNSFTKLSIEPAFTPGPNIELQKDSDCCSCQEKWVGYRCNCYFISSEQKTWNESRHLCASQKSSLLQLQNTDELDFMSSSQQFYWIGLSYSEEHTAWLWENGSALSQYLFPSFETFNTKNCIAYNPNGNALDESCEDKNRYICKQQLI |
Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Notes : | For research use only, not for use in diagnostic procedure. |
Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
Concentration : | ≥0.5 mg/mL |
Storage Buffer : | PBS, 4M Urea, pH7.4 |
Gene Name | KLRD1 killer cell lectin-like receptor subfamily D, member 1 [ Homo sapiens (human) ] |
Official Symbol | KLRD1 |
Synonyms | KLRD1; killer cell lectin-like receptor subfamily D, member 1; CD94; natural killer cells antigen CD94; KP43; CD94 antigen; NK cell receptor; |
Gene ID | 3824 |
mRNA Refseq | NM_001114396 |
Protein Refseq | NP_001107868 |
MIM | 602894 |
UniProt ID | Q13241 |
◆ Recombinant Proteins | ||
KLRD1-4363H | Recombinant Human KLRD1 Protein (Lys32-Ile179), C-His tagged | +Inquiry |
KLRD1-089H | Recombinant Human KLRD1 Protein, His-tagged | +Inquiry |
KLRD1-2381H | Recombinant Human KLRD1 protein(Lys32-Ile179), hFc-tagged | +Inquiry |
KLRD1-4839H | Recombinant Human KLRD1 protein, His-tagged | +Inquiry |
KLRD1-8785M | Recombinant Mouse KLRD1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
KLRD1-4893HCL | Recombinant Human KLRD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KLRD1 Products
Required fields are marked with *
My Review for All KLRD1 Products
Required fields are marked with *
0
Inquiry Basket