Recombinant Full Length Human KLRD1 Protein

Cat.No. : KLRD1-267HF
Product Overview : Recombinant full length Human CD94 with N-terminal proprietary tag. Predicted MW 45.1kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Protein Length : 179 amino acids
Description : Natural killer (NK) cells are a distinct lineage of lymphocytes that mediate cytotoxic activity and secrete cytokines upon immune stimulation. Several genes of the C-type lectin superfamily, including members of the NKG2 family, are expressed by NK cells and may be involved in the regulation of NK cell function. KLRD1 (CD94) is an antigen preferentially expressed on NK cells and is classified as a type II membrane protein because it has an external C terminus. Three transcript variants encoding two different isoforms have been found for this gene.
Form : Liquid
Molecular Mass : 45.100kDa inclusive of tags
AA Sequence : MAVFKTTLWRLISGTLGIICLSLMATLGILLKNSFTKLSI EPAFTPGPNIELQKDSDCCSCQEKWVGYRCNCYFISSEQK TWNESRHLCASQKSSLLQLQNTDELDFMSSSRQFYWIGLS YSEEHTAWLWENGSALSQYLFPSFETFNTKNCIAYNPNGN ALDESCEDKNRYICKQQLI
Purity : Proprietary Purification
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
Storage Buffer : pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.
Gene Name KLRD1 killer cell lectin-like receptor subfamily D, member 1 [ Homo sapiens ]
Official Symbol KLRD1
Synonyms KLRD1; killer cell lectin-like receptor subfamily D, member 1; CD94; natural killer cells antigen CD94
Gene ID 3824
mRNA Refseq NM_001114396
Protein Refseq NP_001107868
MIM 602894
UniProt ID Q13241

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All KLRD1 Products

Required fields are marked with *

My Review for All KLRD1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon