Recombinant Full Length Human KLRD1 Protein
Cat.No. : | KLRD1-267HF |
Product Overview : | Recombinant full length Human CD94 with N-terminal proprietary tag. Predicted MW 45.1kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 179 amino acids |
Description : | Natural killer (NK) cells are a distinct lineage of lymphocytes that mediate cytotoxic activity and secrete cytokines upon immune stimulation. Several genes of the C-type lectin superfamily, including members of the NKG2 family, are expressed by NK cells and may be involved in the regulation of NK cell function. KLRD1 (CD94) is an antigen preferentially expressed on NK cells and is classified as a type II membrane protein because it has an external C terminus. Three transcript variants encoding two different isoforms have been found for this gene. |
Form : | Liquid |
Molecular Mass : | 45.100kDa inclusive of tags |
AA Sequence : | MAVFKTTLWRLISGTLGIICLSLMATLGILLKNSFTKLSI EPAFTPGPNIELQKDSDCCSCQEKWVGYRCNCYFISSEQK TWNESRHLCASQKSSLLQLQNTDELDFMSSSRQFYWIGLS YSEEHTAWLWENGSALSQYLFPSFETFNTKNCIAYNPNGN ALDESCEDKNRYICKQQLI |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | KLRD1 killer cell lectin-like receptor subfamily D, member 1 [ Homo sapiens ] |
Official Symbol | KLRD1 |
Synonyms | KLRD1; killer cell lectin-like receptor subfamily D, member 1; CD94; natural killer cells antigen CD94 |
Gene ID | 3824 |
mRNA Refseq | NM_001114396 |
Protein Refseq | NP_001107868 |
MIM | 602894 |
UniProt ID | Q13241 |
◆ Recombinant Proteins | ||
KLRD1-3298R | Recombinant Rat KLRD1 Protein | +Inquiry |
KLRD1-2954R | Recombinant Rat KLRD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
KLRD1-388H | Recombinant Human KLRD1 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
KLRD1-66M | Recombinant Mouse KLRD1 Protein, His-tagged | +Inquiry |
KLRD1-6922H | Recombinant Human KLRD1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
KLRD1-4893HCL | Recombinant Human KLRD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All KLRD1 Products
Required fields are marked with *
My Review for All KLRD1 Products
Required fields are marked with *