Recombinant Human LAMC1

Cat.No. : LAMC1-27945TH
Product Overview : Recombinant full length Human Laminin gamma 1 with N terminal proprietary tag; predicted MWt 30.29kDa inclusive of tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 39 amino acids
Description : Laminins, a family of extracellular matrix glycoproteins, are the major noncollagenous constituent of basement membranes. They have been implicated in a wide variety of biological processes including cell adhesion, differentiation, migration, signaling, neurite outgrowth and metastasis. Laminins, composed of 3 non identical chains: laminin alpha, beta and gamma (formerly A, B1, and B2, respectively), have a cruciform structure consisting of 3 short arms, each formed by a different chain, and a long arm composed of all 3 chains. Each laminin chain is a multidomain protein encoded by a distinct gene. Several isoforms of each chain have been described. Different alpha, beta and gamma chain isomers combine to give rise to different heterotrimeric laminin isoforms which are designated by Arabic numerals in the order of their discovery, i.e. alpha1beta1gamma1 heterotrimer is laminin 1. The biological functions of the different chains and trimer molecules are largely unknown, but some of the chains have been shown to differ with respect to their tissue distribution, presumably reflecting diverse functions in vivo. This gene encodes the gamma chain isoform laminin, gamma 1. The gamma 1 chain, formerly thought to be a beta chain, contains structural domains similar to beta chains, however, lacks the short alpha region separating domains I and II. The structural organization of this gene also suggested that it had diverged considerably from the beta chain genes. Embryos of transgenic mice in which both alleles of the gamma 1 chain gene were inactivated by homologous recombination, lacked basement membranes, indicating that laminin, gamma 1 chain is necessary for laminin heterotrimer assembly. It has been inferred by analogy with the strikingly similar 3 UTR sequence in mouse laminin gamma 1 cDNA, that multiple polyadenylation sites are utilized in human to generate the 2 different sized mRNAs (5.5 and 7.5 kb) seen on Northern analysis.
Molecular Weight : 30.290kDa
Tissue specificity : Found in the basement membranes (major component).
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MNKRRTSHRIWKNKLPEYMRRPKGPVTKLWRSMPAWLS
Sequence Similarities : Contains 11 laminin EGF-like domains.Contains 1 laminin IV type A domain.Contains 1 laminin N-terminal domain.
Gene Name LAMC1 laminin, gamma 1 (formerly LAMB2) [ Homo sapiens ]
Official Symbol LAMC1
Synonyms LAMC1; laminin, gamma 1 (formerly LAMB2); LAMB2; laminin subunit gamma-1;
Gene ID 3915
mRNA Refseq NM_002293
Protein Refseq NP_002284
MIM 150290
Uniprot ID P11047
Chromosome Location 1q31
Pathway Alpha6-Beta4 Integrin Signaling Pathway, organism-specific biosystem; Amoebiasis, organism-specific biosystem; Amoebiasis, conserved biosystem; Axon guidance, organism-specific biosystem; Developmental Biology, organism-specific biosystem;
Function extracellular matrix structural constituent;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All LAMC1 Products

Required fields are marked with *

My Review for All LAMC1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon