Recombinant Human MAPK11, His-tagged
Cat.No. : | MAPK11-27606TH |
Product Overview : | Recombinant full length protein, corresponding to amino acids 1-364 of Human MAPK11, with an N-terminal His tag, 387aa, 43.8 kDa. |
- Specification
- Gene Information
- Related Products
Description : | The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation, and development. This kinase is most closely related to p38 MAP kinase, both of which can be activated by proinflammatory cytokines and environmental stress. This kinase is activated through its phosphorylation by MAP kinase kinases (MKKs), preferably by MKK6. Transcription factor ATF2/CREB2 has been shown to be a substrate of this kinase. |
Protein length : | 364 amino acids |
Conjugation : | HIS |
Molecular Weight : | 43.800kDa inclusive of tags |
Source : | E. coli |
Tissue specificity : | Highest levels in the brain and heart. Also expressed in the placenta, lung, liver, skeletal muscle, kidney and pancreas. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 0.03% DTT, 20% Glycerol, 0.58% Sodium chloride |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMGSMSGPRAGFYRQELNKTV WEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSR PFQSLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIE DFSEVYLVTTLMGADLNNIVKCQALSDEHVQFLVYQLLRG LKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADE EMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELL QGKALFPGSDYIDQLKRIMEVVGTPSPEVLAKISSEHART YIQSLPPMPQKDLSSIFRGANPLAIDLLGRMLVLDSDQRV SAAEALAHAYFSQYHDPEDEPEAEPYDESVEAKERTLEEW KELTYQEVLSFKPPEPPKPPGSLEIEQ |
Sequence Similarities : | Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MAP kinase subfamily.Contains 1 protein kinase domain. |
Gene Name : | MAPK11 mitogen-activated protein kinase 11 [ Homo sapiens ] |
Official Symbol : | MAPK11 |
Synonyms : | MAPK11; mitogen-activated protein kinase 11; PRKM11; p38 2; p38Beta; SAPK2; |
Gene ID : | 5600 |
mRNA Refseq : | NM_002751 |
Protein Refseq : | NP_002742 |
MIM : | 602898 |
Uniprot ID : | Q15759 |
Chromosome Location : | 22q13.33 |
Pathway : | ATF-2 transcription factor network, organism-specific biosystem; Activated TLR4 signalling, organism-specific biosystem; Activation of the AP-1 family of transcription factors, organism-specific biosystem; Amyotrophic lateral sclerosis (ALS), organism-specific biosystem; Amyotrophic lateral sclerosis (ALS), conserved biosystem; |
Function : | ATP binding; MAP kinase activity; nucleotide binding; protein binding; protein serine/threonine kinase activity; |
Products Types
◆ Recombinant Protein | ||
MAPK11-5344M | Recombinant Mouse MAPK11 Protein, His (Fc)-Avi-tagged | +Inquiry |
MAPK11-1085H | Recombinant Human MAPK11 Protein (S2-Q364), GST tagged | +Inquiry |
Mapk11-3939M | Recombinant Mouse Mapk11 Protein, Myc/DDK-tagged | +Inquiry |
MAPK11-1084H | Recombinant Human MAPK11 Protein (S2-Q364), Tag Free | +Inquiry |
MAPK11-1375C | Recombinant Chicken MAPK11 | +Inquiry |
◆ Lysates | ||
MAPK11-4496HCL | Recombinant Human MAPK11 293 Cell Lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket