Recombinant Human MAPK11, His-tagged

Cat.No. : MAPK11-27606TH
Product Overview : Recombinant full length protein, corresponding to amino acids 1-364 of Human MAPK11, with an N-terminal His tag, 387aa, 43.8 kDa.
  • Specification
  • Gene Information
  • Related Products
Description : The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation, and development. This kinase is most closely related to p38 MAP kinase, both of which can be activated by proinflammatory cytokines and environmental stress. This kinase is activated through its phosphorylation by MAP kinase kinases (MKKs), preferably by MKK6. Transcription factor ATF2/CREB2 has been shown to be a substrate of this kinase.
Protein length : 364 amino acids
Conjugation : HIS
Molecular Weight : 43.800kDa inclusive of tags
Source : E. coli
Tissue specificity : Highest levels in the brain and heart. Also expressed in the placenta, lung, liver, skeletal muscle, kidney and pancreas.
Form : Liquid
Purity : >90% by SDS-PAGE
Storage buffer : pH: 8.00Constituents:0.32% Tris HCl, 0.03% DTT, 20% Glycerol, 0.58% Sodium chloride
Storage : Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.
Sequences of amino acids : MGSSHHHHHHSSGLVPRGSHMGSMSGPRAGFYRQELNKTV WEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSR PFQSLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIE DFSEVYLVTTLMGADLNNIVKCQALSDEHVQFLVYQLLRG LKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADE EMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELL QGKALFPGSDYIDQLKRIMEVVGTPSPEVLAKISSEHART YIQSLPPMPQKDLSSIFRGANPLAIDLLGRMLVLDSDQRV SAAEALAHAYFSQYHDPEDEPEAEPYDESVEAKERTLEEW KELTYQEVLSFKPPEPPKPPGSLEIEQ
Sequence Similarities : Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MAP kinase subfamily.Contains 1 protein kinase domain.
Gene Name : MAPK11 mitogen-activated protein kinase 11 [ Homo sapiens ]
Official Symbol : MAPK11
Synonyms : MAPK11; mitogen-activated protein kinase 11; PRKM11; p38 2; p38Beta; SAPK2;
Gene ID : 5600
mRNA Refseq : NM_002751
Protein Refseq : NP_002742
MIM : 602898
Uniprot ID : Q15759
Chromosome Location : 22q13.33
Pathway : ATF-2 transcription factor network, organism-specific biosystem; Activated TLR4 signalling, organism-specific biosystem; Activation of the AP-1 family of transcription factors, organism-specific biosystem; Amyotrophic lateral sclerosis (ALS), organism-specific biosystem; Amyotrophic lateral sclerosis (ALS), conserved biosystem;
Function : ATP binding; MAP kinase activity; nucleotide binding; protein binding; protein serine/threonine kinase activity;

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All MAPK11 Products

Required fields are marked with *

My Review for All MAPK11 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

Stay Updated on the
Latest Bioscience Trends

Copyright © 2023 Creative BioMart. All Rights Reserved.

Terms and Conditions        Privacy Policy