Recombinant Human MAPK12 protein, His-tagged
Cat.No. : | MAPK12-1340H |
Product Overview : | Recombinant Human MAPK12 protein(NP_002960)(216-349 aa), fused with His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 216-349 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
AA Sequence : | MAEMITGKTLFKGSDHLDQLKEIMKVTGTPPAEFVQRLQSDEAKNYMKGLPELEKKDFASILTNASPLAVNLLEKMLVLDAEQRVTAGEALAHPYFESLHDTEDEPQVQKYDDSFDDVDRTLDEWKRVTYKEVL |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | MAPK12 mitogen-activated protein kinase 12 [ Homo sapiens ] |
Official Symbol | MAPK12 |
Synonyms | MAPK12; mitogen-activated protein kinase 12; SAPK3; ERK6; p38gamma; PRKM12; SAPK 3; ERK-6; MAPK 12; MAP kinase 12; MAP kinase p38 gamma; stress-activated protein kinase 3; mitogen-activated protein kinase 3; extracellular signal-regulated kinase 6; mitogen-activated protein kinase p38 gamma; ERK3; SAPK-3; P38GAMMA; |
Gene ID | 6300 |
mRNA Refseq | NM_002969 |
Protein Refseq | NP_002960 |
MIM | 602399 |
UniProt ID | P53778 |
◆ Recombinant Proteins | ||
MAPK12-9528M | Recombinant Mouse MAPK12 Protein | +Inquiry |
MAPK12-738H | Recombinant Human Mitogen-activated Protein Kinase 12 | +Inquiry |
MAPK12-264H | Recombinant Human MAPK12, Gly & Pro tagged | +Inquiry |
MAPK12-3572R | Recombinant Rat MAPK12 Protein | +Inquiry |
MAPK12-0285H | Recombinant Human MAPK12 protein, His&GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAPK12-001HCL | Recombinant Human MAPK12 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MAPK12 Products
Required fields are marked with *
My Review for All MAPK12 Products
Required fields are marked with *