Recombinant Human MAPK12 protein, His-tagged

Cat.No. : MAPK12-1340H
Product Overview : Recombinant Human MAPK12 protein(NP_002960)(216-349 aa), fused with His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 216-349 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization.
AA Sequence : MAEMITGKTLFKGSDHLDQLKEIMKVTGTPPAEFVQRLQSDEAKNYMKGLPELEKKDFASILTNASPLAVNLLEKMLVLDAEQRVTAGEALAHPYFESLHDTEDEPQVQKYDDSFDDVDRTLDEWKRVTYKEVL
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name MAPK12 mitogen-activated protein kinase 12 [ Homo sapiens ]
Official Symbol MAPK12
Synonyms MAPK12; mitogen-activated protein kinase 12; SAPK3; ERK6; p38gamma; PRKM12; SAPK 3; ERK-6; MAPK 12; MAP kinase 12; MAP kinase p38 gamma; stress-activated protein kinase 3; mitogen-activated protein kinase 3; extracellular signal-regulated kinase 6; mitogen-activated protein kinase p38 gamma; ERK3; SAPK-3; P38GAMMA;
Gene ID 6300
mRNA Refseq NM_002969
Protein Refseq NP_002960
MIM 602399
UniProt ID P53778

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MAPK12 Products

Required fields are marked with *

My Review for All MAPK12 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon