Recombinant Human METTL27 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | METTL27-2178H |
Product Overview : | WBSCR27 MS Standard C13 and N15-labeled recombinant protein (NP_689772) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This gene encodes a protein belonging to ubiE/COQ5 methyltransferase family. The gene is deleted in Williams syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at 7q11.22-q11.23. |
Molecular Mass : | 26.7 kDa |
AA Sequence : | MAQEEGGSLPEVRARVRAAHGIPDLAQKLHFYDRWAPDYDQDVATLLYRAPRLAVDCLTQALPGPPHSALILDVACGTGLVAAELRAPGFLQLHGVDGSPGMLEQARAPGLYQRLSLCTLGQEPLPSPEGTFDAVLIVGALSDGQVPCNAIPELHVTKPGGLVCLTTRTNWSNLQYKEALEATLDRLEQAGMWEGLVAWPVDRLWTAGSWLPPSWWWYPASLPRMASSPALSTCTESGRRPRLRKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | METTL27 methyltransferase like 27 [ Homo sapiens (human) ] |
Official Symbol | METTL27 |
Synonyms | METTL27; methyltransferase like 27; WBSCR27; methyltransferase-like protein 27; Williams Beuren syndrome chromosome region 27; williams-Beuren syndrome chromosomal region 27 protein |
Gene ID | 155368 |
mRNA Refseq | NM_152559 |
Protein Refseq | NP_689772 |
MIM | 612546 |
UniProt ID | Q8N6F8 |
◆ Recombinant Proteins | ||
Mettl27-4047M | Recombinant Mouse Mettl27 Protein, Myc/DDK-tagged | +Inquiry |
METTL27-2178H | Recombinant Human METTL27 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All METTL27 Products
Required fields are marked with *
My Review for All METTL27 Products
Required fields are marked with *