Recombinant Human METTL27 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: METTL27-2178H
• Product Overview: WBSCR27 MS Standard C13 and N15-labeled recombinant protein (NP_689772) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a protein belonging to ubiE/COQ5 methyltransferase family. The gene is deleted in Williams syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at 7q11.22-q11.23.
• Molecular Mass: 26.7 kDa
• AA Sequence: MAQEEGGSLPEVRARVRAAHGIPDLAQKLHFYDRWAPDYDQDVATLLYRAPRLAVDCLTQALPGPPHSALILDVACGTGLVAAELRAPGFLQLHGVDGSPGMLEQARAPGLYQRLSLCTLGQEPLPSPEGTFDAVLIVGALSDGQVPCNAIPELHVTKPGGLVCLTTRTNWSNLQYKEALEATLDRLEQAGMWEGLVAWPVDRLWTAGSWLPPSWWWYPASLPRMASSPALSTCTESGRRPRLRKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: METTL27 methyltransferase like 27 [ Homo sapiens (human) ]
• Official Symbol: METTL27
• Synonyms: METTL27; methyltransferase like 27; WBSCR27; methyltransferase-like protein 27; Williams Beuren syndrome chromosome region 27; williams-Beuren syndrome chromosomal region 27 protein
• Gene ID: 155368
• mRNA Refseq: NM_152559
• Protein Refseq: NP_689772
• MIM: 612546
• UniProt ID: Q8N6F8