Recombinant Human METTL27 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : METTL27-2178H
Product Overview : WBSCR27 MS Standard C13 and N15-labeled recombinant protein (NP_689772) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a protein belonging to ubiE/COQ5 methyltransferase family. The gene is deleted in Williams syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at 7q11.22-q11.23.
Molecular Mass : 26.7 kDa
AA Sequence : MAQEEGGSLPEVRARVRAAHGIPDLAQKLHFYDRWAPDYDQDVATLLYRAPRLAVDCLTQALPGPPHSALILDVACGTGLVAAELRAPGFLQLHGVDGSPGMLEQARAPGLYQRLSLCTLGQEPLPSPEGTFDAVLIVGALSDGQVPCNAIPELHVTKPGGLVCLTTRTNWSNLQYKEALEATLDRLEQAGMWEGLVAWPVDRLWTAGSWLPPSWWWYPASLPRMASSPALSTCTESGRRPRLRKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name METTL27 methyltransferase like 27 [ Homo sapiens (human) ]
Official Symbol METTL27
Synonyms METTL27; methyltransferase like 27; WBSCR27; methyltransferase-like protein 27; Williams Beuren syndrome chromosome region 27; williams-Beuren syndrome chromosomal region 27 protein
Gene ID 155368
mRNA Refseq NM_152559
Protein Refseq NP_689772
MIM 612546
UniProt ID Q8N6F8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All METTL27 Products

Required fields are marked with *

My Review for All METTL27 Products

Required fields are marked with *

0
cart-icon
0
compare icon