Recombinant Human MIA protein
Cat.No. : | MIA-140H |
Product Overview : | Recombinant Human MIA protein was expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | Non |
Protein Length : | 107 |
Form : | Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4, with 5 % Trehalose. |
Bio-activity : | Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human A375 cell line is less than 5 μg/ml, corresponding to a specific activity of > 200 IU/mg. |
Molecular Mass : | Approximately 12.1 kDa, a single non-glycosylated polypeptide chain containing 107 amino acids. |
AA Sequence : | GPMPKLADRKLCADQECSHPISMAVALQDYMAPDCRFLTIHRGQVVYVFSKLKGRGRLFWGGSVQGDYYGDLAARLGYFPSSIVREDQTLKPGKVDVKTDKWDFYCQ |
Endotoxin : | Less than 0.1 EU/µg of rHuMIA as determined by LAL method. |
Purity : | >98% by SDS-PAGE and HPLC analysis. |
Storage : | Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | MIA |
Official Symbol | MIA |
Synonyms | MIA; melanoma inhibitory activity; melanoma-derived growth regulatory protein; CD RAP; CD-RAP; |
Gene ID | 8190 |
mRNA Refseq | NM_001202553 |
Protein Refseq | NP_001189482 |
MIM | 601340 |
UniProt ID | Q16674 |
◆ Recombinant Proteins | ||
Mia-1542M | Recombinant Mouse Mia protein, His & T7-tagged | +Inquiry |
MIA-6549HF | Recombinant Full Length Human MIA Protein, GST-tagged | +Inquiry |
Mia-1543R | Recombinant Rat Mia protein, His & GST-tagged | +Inquiry |
MIA-196H | Recombinant Human MIA protein | +Inquiry |
MIA-5001H | Recombinant Human MIA, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MIA-4325HCL | Recombinant Human MIA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MIA Products
Required fields are marked with *
My Review for All MIA Products
Required fields are marked with *
0
Inquiry Basket