Recombinant Human MIA protein

Cat.No. : MIA-140H
Product Overview : Recombinant Human MIA protein was expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 107
Form : Lyophilized from a 0.2μm filtered concentrated solution in PBS, pH 7.4, with 5 % Trehalose.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by a cell proliferation assay using human A375 cell line is less than 5 μg/ml, corresponding to a specific activity of > 200 IU/mg.
Molecular Mass : Approximately 12.1 kDa, a single non-glycosylated polypeptide chain containing 107 amino acids.
AA Sequence : GPMPKLADRKLCADQECSHPISMAVALQDYMAPDCRFLTIHRGQVVYVFSKLKGRGRLFWGGSVQGDYYGDLAARLGYFPSSIVREDQTLKPGKVDVKTDKWDFYCQ
Endotoxin : Less than 0.1 EU/µg of rHuMIA as determined by LAL method.
Purity : >98% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name MIA
Official Symbol MIA
Synonyms MIA; melanoma inhibitory activity; melanoma-derived growth regulatory protein; CD RAP; CD-RAP;
Gene ID 8190
mRNA Refseq NM_001202553
Protein Refseq NP_001189482
MIM 601340
UniProt ID Q16674

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MIA Products

Required fields are marked with *

My Review for All MIA Products

Required fields are marked with *

0

Inquiry Basket

cartIcon