Recombinant Human MS4A1 protein(209-297aa), GST-tagged

Cat.No. : MS4A1-533H
Product Overview : Recombinant Human MS4A1 protein(P11836)(209-297aa), fused with N-terminal GST tag, was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 209-297aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 36.9 kDa
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
AA Sequence : IAGIVENEWKRTCSRPKSNIVLLSAEEKKEQTIEIKEEVVGLTETSSQPKNEEDIEIIPIQEEEEEETETNFPEPPQDQESSPIENDSSP
Gene Name MS4A1 membrane-spanning 4-domains, subfamily A, member 1 [ Homo sapiens ]
Official Symbol MS4A1
Synonyms MS4A1; membrane-spanning 4-domains, subfamily A, member 1; CD20; B-lymphocyte antigen CD20; B1; Bp35; MS4A2; CD20 antigen; CD20 receptor; leukocyte surface antigen Leu-16; B-lymphocyte cell-surface antigen B1; S7; CVID5; LEU-16; MGC3969;
Gene ID 931
mRNA Refseq NM_021950
Protein Refseq NP_068769
MIM 112210
UniProt ID P11836

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MS4A1 Products

Required fields are marked with *

My Review for All MS4A1 Products

Required fields are marked with *

0
cart-icon
0
compare icon