Recombinant Human MS4A1 protein(209-297aa), GST-tagged
Cat.No. : | MS4A1-533H |
Product Overview : | Recombinant Human MS4A1 protein(P11836)(209-297aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 209-297aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 36.9 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | IAGIVENEWKRTCSRPKSNIVLLSAEEKKEQTIEIKEEVVGLTETSSQPKNEEDIEIIPIQEEEEEETETNFPEPPQDQESSPIENDSSP |
Gene Name | MS4A1 membrane-spanning 4-domains, subfamily A, member 1 [ Homo sapiens ] |
Official Symbol | MS4A1 |
Synonyms | MS4A1; membrane-spanning 4-domains, subfamily A, member 1; CD20; B-lymphocyte antigen CD20; B1; Bp35; MS4A2; CD20 antigen; CD20 receptor; leukocyte surface antigen Leu-16; B-lymphocyte cell-surface antigen B1; S7; CVID5; LEU-16; MGC3969; |
Gene ID | 931 |
mRNA Refseq | NM_021950 |
Protein Refseq | NP_068769 |
MIM | 112210 |
UniProt ID | P11836 |
◆ Recombinant Proteins | ||
MS4A1-62CAF555 | Recombinant Cynomolgus MS4A1 Protein, His-tagged, Alexa Fluor 555 conjugated | +Inquiry |
MS4A1-0157H | Recombinant Human MS4A1 Protein (T2-P297 end), Flag, 8×His tagged | +Inquiry |
MS4A1-3930H | Recombinant Human MS4A1 protein | +Inquiry |
Ms4a1-4893M | Recombinant Mouse Ms4a1 protein, His/SUMO-tagged | +Inquiry |
MS4A1-23HFL | Recombinant Human MS4A1 Protein, Full Length | +Inquiry |
◆ Cell & Tissue Lysates | ||
MS4A1-1848FCL | Recombinant Ferret MS4A1 cell lysate | +Inquiry |
MS4A1-819CCL | Recombinant Cynomolgus MS4A1 cell lysate | +Inquiry |
MS4A1-1542HCL | Recombinant Human MS4A1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MS4A1 Products
Required fields are marked with *
My Review for All MS4A1 Products
Required fields are marked with *