Recombinant Human MS4A1 protein(209-297aa), GST-tagged
| Cat.No. : | MS4A1-533H |
| Product Overview : | Recombinant Human MS4A1 protein(P11836)(209-297aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 209-297aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 36.9 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | IAGIVENEWKRTCSRPKSNIVLLSAEEKKEQTIEIKEEVVGLTETSSQPKNEEDIEIIPIQEEEEEETETNFPEPPQDQESSPIENDSSP |
| Gene Name | MS4A1 membrane-spanning 4-domains, subfamily A, member 1 [ Homo sapiens ] |
| Official Symbol | MS4A1 |
| Synonyms | MS4A1; membrane-spanning 4-domains, subfamily A, member 1; CD20; B-lymphocyte antigen CD20; B1; Bp35; MS4A2; CD20 antigen; CD20 receptor; leukocyte surface antigen Leu-16; B-lymphocyte cell-surface antigen B1; S7; CVID5; LEU-16; MGC3969; |
| Gene ID | 931 |
| mRNA Refseq | NM_021950 |
| Protein Refseq | NP_068769 |
| MIM | 112210 |
| UniProt ID | P11836 |
| ◆ Recombinant Proteins | ||
| MS4A1-09FF | Recombinant Ferret MS4A1 Protein, His-tagged, FITC conjugated | +Inquiry |
| MS4A1-5732M | Recombinant Mouse MS4A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| MS4A1-533H | Recombinant Human MS4A1 protein(209-297aa), GST-tagged | +Inquiry |
| MS4A1-1649H | Recombinant Human MS4A1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| MS4A1-3929H | Recombinant Human MS4A1 full length protein, His-tagged(Nanodisc) | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MS4A1-1542HCL | Recombinant Human MS4A1 cell lysate | +Inquiry |
| MS4A1-1848FCL | Recombinant Ferret MS4A1 cell lysate | +Inquiry |
| MS4A1-819CCL | Recombinant Cynomolgus MS4A1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MS4A1 Products
Required fields are marked with *
My Review for All MS4A1 Products
Required fields are marked with *
