Recombinant Human MSRA Protein, GST-tagged

Cat.No. : MSRA-5665H
Product Overview : Human MSRA full-length ORF ( NP_036463.1, 1 a.a. - 235 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This protein is ubiquitous and highly conserved. It carries out the enzymatic reduction of methionine sulfoxide to methionine. Human and animal studies have shown the highest levels of expression in kidney and nervous tissue. Its proposed function is the repair of oxidative damage to proteins to restore biological activity. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Molecular Mass : 52.5 kDa
AA Sequence : MLSATRRACQLLLLHSLFPVPRMGNSASNIVSPQEALPGRKEQTPVAAKHHVNGNRTVEPFPEGTQMAVFGMGCFWGAERKFWVLKGVYSTQVGFAGGYTSNPTYKEVCSEKTGHAEVVRVVYQPEHMSFEELLKVFWENHDPTQGMRQGNDHGTQYRSAIYPTSAKQMEAALSSKENYQKVLSEHGFGPITTDIREGQTFYYAEDYHQQYLSKNPNGYCGLGGTGVSCPVGIKK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MSRA methionine sulfoxide reductase A [ Homo sapiens ]
Official Symbol MSRA
Synonyms MSRA; methionine sulfoxide reductase A; mitochondrial peptide methionine sulfoxide reductase; peptide Met(O) reductase; peptide met (O) reductase; protein-methionine-S-oxide reductase; peptide methionine sulfoxide reductase; peptide-methionine (S)-S-oxide reductase; cytosolic methionine-S-sulfoxide reductase; PMSR;
Gene ID 4482
mRNA Refseq NM_001135670
Protein Refseq NP_001129142
MIM 601250
UniProt ID Q9UJ68

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MSRA Products

Required fields are marked with *

My Review for All MSRA Products

Required fields are marked with *

0
cart-icon