Recombinant Human MSRA Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : MSRA-4235H
Product Overview : MSRA MS Standard C13 and N15-labeled recombinant protein (NP_036463) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a ubiquitous and highly conserved protein that carries out the enzymatic reduction of methionine sulfoxide to methionine. Human and animal studies have shown the highest levels of expression in kidney and nervous tissue. The protein functions in the repair of oxidatively damaged proteins to restore biological activity. Alternative splicing results in multiple transcript variants.
Molecular Mass : 26.1 kDa
AA Sequence : MLSATRRACQLLLLHSLFPVPRMGNSASNIVSPQEALPGRKEQTPVAAKHHVNGNRTVEPFPEGTQMAVFGMGCFWGAERKFWVLKGVYSTQVGFAGGYTSNPTYKEVCSEKTGHAEVVRVVYQPEHMSFEELLKVFWENHDPTQGMRQGNDHGTQYRSAIYPTSAKQMEAALSSKENYQKVLSEHGFGPITTDIREGQTFYYAEDYHQQYLSKNPNGYCGLGGTGVSCPVGIKKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name MSRA methionine sulfoxide reductase A [ Homo sapiens (human) ]
Official Symbol MSRA
Synonyms MSRA; methionine sulfoxide reductase A; mitochondrial peptide methionine sulfoxide reductase; peptide Met(O) reductase; peptide met (O) reductase; protein-methionine-S-oxide reductase; peptide methionine sulfoxide reductase; peptide-methionine (S)-S-oxide reductase; cytosolic methionine-S-sulfoxide reductase; PMSR;
Gene ID 4482
mRNA Refseq NM_012331
Protein Refseq NP_036463
MIM 601250
UniProt ID Q9UJ68

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MSRA Products

Required fields are marked with *

My Review for All MSRA Products

Required fields are marked with *

0

Inquiry Basket

cartIcon