Recombinant Human MTCH2 Protein, GST-tagged
Cat.No. : | MTCH2-5687H |
Product Overview : | Human MTCH2 full-length ORF ( NP_055157.1, 1 a.a. - 303 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the SLC25 family of nuclear-encoded transporters that are localized in the inner mitochondrial membrane. Members of this superfamily are involved in many metabolic pathways and cell functions. Genome-wide association studies in human have identified single-nucleotide polymorphisms in several loci associated with obesity. This gene is one such locus, which is highly expressed in white adipose tissue and adipocytes, and thought to play a regulatory role in adipocyte differentiation and biology. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. A recent study showed this gene to be an authentic stop codon readthrough target, and that its mRNA can give rise to an additional C-terminally extended isoform by use of an alternative in-frame translation termination codon. [provided by RefSeq, Nov 2015] |
Molecular Mass : | 59.7 kDa |
AA Sequence : | MADAASQVLLGSGLTILSQPLMYVKVLIQVGYEPLPPTIGRNIFGRQVCQLPGLFSYAQHIASIDGRRGLFTGLTPRLCSGVLGTVVHGKVLQHYQESDKGEELGPGNVQKEVSSSFDHVIKETTREMIARSAATLITHPFHVITLRSMVQFIGRESKYCGLCDSIITIYREEGILGFFAGLVPRLLGDILSLWLCNSLAYLVNTYALDSGVSTMNEMKSYSQAVTGFFASMLTYPFVLVSNLMAVNNCGLAGGCPPYSPIYTSWIDCWCMLQKEGNMSRGNSLFFRKVPFGKTYCCDLKMLI |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MTCH2 mitochondrial carrier 2 [ Homo sapiens ] |
Official Symbol | MTCH2 |
Synonyms | MTCH2; mitochondrial carrier 2; mitochondrial carrier homolog 2 (C. elegans); mitochondrial carrier homolog 2; SLC25A50; solute carrier family 25; member 50; 2310034D24Rik; met-induced mitochondrial protein; solute carrier family 25, member 50; MIMP; HSPC032; |
Gene ID | 23788 |
mRNA Refseq | NM_014342 |
Protein Refseq | NP_055157 |
MIM | 613221 |
UniProt ID | Q9Y6C9 |
◆ Recombinant Proteins | ||
RFL7184HF | Recombinant Full Length Human Mitochondrial Carrier Homolog 2(Mtch2) Protein, His-Tagged | +Inquiry |
RFL34848BF | Recombinant Full Length Bovine Mitochondrial Carrier Homolog 2(Mtch2) Protein, His-Tagged | +Inquiry |
MTCH2-713C | Recombinant Cynomolgus MTCH2 Protein, His-tagged | +Inquiry |
MTCH2-1176H | Recombinant Human MTCH2 | +Inquiry |
MTCH2-6483HF | Recombinant Full Length Human MTCH2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MTCH2-4089HCL | Recombinant Human MTCH2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MTCH2 Products
Required fields are marked with *
My Review for All MTCH2 Products
Required fields are marked with *
0
Inquiry Basket