Recombinant Human MTCH2 Protein, GST-tagged

Cat.No. : MTCH2-5687H
Product Overview : Human MTCH2 full-length ORF ( NP_055157.1, 1 a.a. - 303 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the SLC25 family of nuclear-encoded transporters that are localized in the inner mitochondrial membrane. Members of this superfamily are involved in many metabolic pathways and cell functions. Genome-wide association studies in human have identified single-nucleotide polymorphisms in several loci associated with obesity. This gene is one such locus, which is highly expressed in white adipose tissue and adipocytes, and thought to play a regulatory role in adipocyte differentiation and biology. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. A recent study showed this gene to be an authentic stop codon readthrough target, and that its mRNA can give rise to an additional C-terminally extended isoform by use of an alternative in-frame translation termination codon. [provided by RefSeq, Nov 2015]
Molecular Mass : 59.7 kDa
AA Sequence : MADAASQVLLGSGLTILSQPLMYVKVLIQVGYEPLPPTIGRNIFGRQVCQLPGLFSYAQHIASIDGRRGLFTGLTPRLCSGVLGTVVHGKVLQHYQESDKGEELGPGNVQKEVSSSFDHVIKETTREMIARSAATLITHPFHVITLRSMVQFIGRESKYCGLCDSIITIYREEGILGFFAGLVPRLLGDILSLWLCNSLAYLVNTYALDSGVSTMNEMKSYSQAVTGFFASMLTYPFVLVSNLMAVNNCGLAGGCPPYSPIYTSWIDCWCMLQKEGNMSRGNSLFFRKVPFGKTYCCDLKMLI
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MTCH2 mitochondrial carrier 2 [ Homo sapiens ]
Official Symbol MTCH2
Synonyms MTCH2; mitochondrial carrier 2; mitochondrial carrier homolog 2 (C. elegans); mitochondrial carrier homolog 2; SLC25A50; solute carrier family 25; member 50; 2310034D24Rik; met-induced mitochondrial protein; solute carrier family 25, member 50; MIMP; HSPC032;
Gene ID 23788
mRNA Refseq NM_014342
Protein Refseq NP_055157
MIM 613221
UniProt ID Q9Y6C9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MTCH2 Products

Required fields are marked with *

My Review for All MTCH2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon