Recombinant Human MYL12B Protein, GST-tagged
Cat.No. : | MYL12B-5548H |
Product Overview : | Human MRLC2 full-length ORF ( NP_291024.1, 1 a.a. - 172 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | The activity of nonmuscle myosin II (see MYH9; MIM 160775) is regulated by phosphorylation of a regulatory light chain, such as MRLC2. This phosphorylation results in higher MgATPase activity and the assembly of myosin II filaments (Iwasaki et al., 2001 [PubMed 11942626]).[supplied by OMIM |
Molecular Mass : | 46.2 kDa |
AA Sequence : | MSSKKAKTKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDAYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MYL12B myosin light chain 12B [ Homo sapiens (human) ] |
Official Symbol | MYL12B |
Synonyms | MYL12B; myosin light chain 12B; MLC-B; MRLC2; myosin regulatory light chain 12B; MLC-2; MLC-2A; MLC20; SHUJUN-1; myosin regulatory light chain 2; myosin regulatory light chain 2-B, smooth muscle isoform; myosin regulatory light chain 20 kDa; myosin regulatory light chain MRLC2; myosin, light chain 12B, regulatory |
Gene ID | 103910 |
mRNA Refseq | NM_001144944 |
Protein Refseq | NP_001138416 |
MIM | 609211 |
UniProt ID | O14950 |
◆ Recombinant Proteins | ||
MYL12B-5845M | Recombinant Mouse MYL12B Protein, His (Fc)-Avi-tagged | +Inquiry |
MYL12B-6369HF | Recombinant Full Length Human MYL12B Protein, GST-tagged | +Inquiry |
MYL12B-3512R | Recombinant Rat MYL12B Protein, His (Fc)-Avi-tagged | +Inquiry |
Myl12b-4249M | Recombinant Mouse Myl12b Protein, Myc/DDK-tagged | +Inquiry |
MYL12B-10313M | Recombinant Mouse MYL12B Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MYL12B-4029HCL | Recombinant Human MYL12B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MYL12B Products
Required fields are marked with *
My Review for All MYL12B Products
Required fields are marked with *