Recombinant Human NCBP1
Cat.No. : | NCBP1-29294TH |
Product Overview : | Recombinant fragment of Human NCBP1 with an N terminal proprietary tag; Predicted MW 36.41kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 98 amino acids |
Description : | The product of this gene is a component of the nuclear cap-binding protein complex (CBC), which binds to the monomethylated 5 cap of nascent pre-mRNA in the nucleoplasm. The encoded protein promotes high-affinity mRNA-cap binding and associates with the CTD of RNA polymerase II. The CBC promotes pre-mRNA splicing, 3-end processing, RNA nuclear export, and nonsense-mediated mRNA decay. |
Molecular Weight : | 36.410kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | SRRRHSDENDGGQPHKRRKTSDANETEDHLESLICKVGEKSACSLESNLEGLAGVLEADLPNYKSKILRLLCTVARLLPEKLTIYTTLVGLLNARNYN |
Sequence Similarities : | Belongs to the NCBP1 family.Contains 1 MIF4G domain. |
Gene Name | NCBP1 nuclear cap binding protein subunit 1, 80kDa [ Homo sapiens ] |
Official Symbol | NCBP1 |
Synonyms | NCBP1; nuclear cap binding protein subunit 1, 80kDa; NCBP, nuclear cap binding protein subunit 1, 80kD; nuclear cap-binding protein subunit 1; CBP80; Sto1; |
Gene ID | 4686 |
mRNA Refseq | NM_002486 |
Protein Refseq | NP_002477 |
MIM | 600469 |
Uniprot ID | Q09161 |
Chromosome Location | 9q34.1 |
Pathway | Abortive elongation of HIV-1 transcript in the absence of Tat, organism-specific biosystem; Cap binding complex, organism-specific biosystem; Cleavage of Growing Transcript in the Termination Region, organism-specific biosystem; Formation and Maturation of mRNA Transcript, organism-specific biosystem; Formation of HIV-1 elongation complex containing HIV-1 Tat, organism-specific biosystem; |
Function | RNA binding; RNA cap binding; protein binding; |
◆ Recombinant Proteins | ||
NCBP1-10462M | Recombinant Mouse NCBP1 Protein | +Inquiry |
NCBP1-29240TH | Recombinant Human NCBP1 | +Inquiry |
NCBP1-3088C | Recombinant Chicken NCBP1 | +Inquiry |
NCBP1-1484H | Recombinant Human NCBP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
NCBP1-3575R | Recombinant Rat NCBP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NCBP1-1171HCL | Recombinant Human NCBP1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All NCBP1 Products
Required fields are marked with *
My Review for All NCBP1 Products
Required fields are marked with *
0
Inquiry Basket