Recombinant Human NCBP1

Cat.No. : NCBP1-29294TH
Product Overview : Recombinant fragment of Human NCBP1 with an N terminal proprietary tag; Predicted MW 36.41kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 98 amino acids
Description : The product of this gene is a component of the nuclear cap-binding protein complex (CBC), which binds to the monomethylated 5 cap of nascent pre-mRNA in the nucleoplasm. The encoded protein promotes high-affinity mRNA-cap binding and associates with the CTD of RNA polymerase II. The CBC promotes pre-mRNA splicing, 3-end processing, RNA nuclear export, and nonsense-mediated mRNA decay.
Molecular Weight : 36.410kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : SRRRHSDENDGGQPHKRRKTSDANETEDHLESLICKVGEKSACSLESNLEGLAGVLEADLPNYKSKILRLLCTVARLLPEKLTIYTTLVGLLNARNYN
Sequence Similarities : Belongs to the NCBP1 family.Contains 1 MIF4G domain.
Gene Name NCBP1 nuclear cap binding protein subunit 1, 80kDa [ Homo sapiens ]
Official Symbol NCBP1
Synonyms NCBP1; nuclear cap binding protein subunit 1, 80kDa; NCBP, nuclear cap binding protein subunit 1, 80kD; nuclear cap-binding protein subunit 1; CBP80; Sto1;
Gene ID 4686
mRNA Refseq NM_002486
Protein Refseq NP_002477
MIM 600469
Uniprot ID Q09161
Chromosome Location 9q34.1
Pathway Abortive elongation of HIV-1 transcript in the absence of Tat, organism-specific biosystem; Cap binding complex, organism-specific biosystem; Cleavage of Growing Transcript in the Termination Region, organism-specific biosystem; Formation and Maturation of mRNA Transcript, organism-specific biosystem; Formation of HIV-1 elongation complex containing HIV-1 Tat, organism-specific biosystem;
Function RNA binding; RNA cap binding; protein binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All NCBP1 Products

Required fields are marked with *

My Review for All NCBP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon