Recombinant Human NNMT protein, His-tagged
Cat.No. : | NNMT-218H |
Product Overview : | Recombinant mature human NNMT cDNA (264 aa) fused with human Alpha-Fetal Protein N-terminal domain (AFPn)-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 264 a.a. |
Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, Sucrose and DTT. |
AA Sequence : | MTLHRNEYGIASILDSYQCTAEISLADLATIFFAQFVQEATYKEVSKMVKDALTAIEKPTGDEQSSGCLENQLPA FLEELCHEKEILEKYGHSDCCSQSEEGRHNCFLAHKKPTPASIPLFQVPEPVTSCEAYEEDRETFMNKFIYEIAR RHPFLYAPTILLWAARYDKIIPSCCKAENAVECFQTKAATVTKELRESSGGSHHHHHHGSENLYFQGEFMESGFT SKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQLLSACESFKEI VVTDYSDQNLQELEKWLKKEPEAFDWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPP ADCVLSTLCLDAACPDLPTYCRALRNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYT IEWFEVISQSYSSTMANNEGLFSLVARKLSRPL |
Purity : | >90% by SDS-PAGE |
Storage : | Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days. |
Gene Name | NNMT nicotinamide N-methyltransferase [ Homo sapiens ] |
Official Symbol | NNMT |
Synonyms | NNMT; nicotinamide N-methyltransferase; |
Gene ID | 4837 |
mRNA Refseq | NM_006169 |
Protein Refseq | NP_006160 |
MIM | 600008 |
UniProt ID | P40261 |
Chromosome Location | 11q23.1 |
Pathway | Biological oxidations, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Methylation, organism-specific biosystem; Nicotinate and nicotinamide metabolism, organism-specific biosystem; Nicotinate and nicotinamide metabolism, conserved biosystem; Phase II conjugation, organism-specific biosystem; |
Function | methyltransferase activity; nicotinamide N-methyltransferase activity; transferase activity; |
◆ Recombinant Proteins | ||
NNMT-2158HFL | Recombinant Full Length Human NNMT protein, Flag-tagged | +Inquiry |
Nnmt-4449M | Recombinant Mouse Nnmt Protein, Myc/DDK-tagged | +Inquiry |
NNMT-185H | Recombinant Human NNMT Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
NNMT-10759M | Recombinant Mouse NNMT Protein | +Inquiry |
NNMT-193H | Active Recombinant Human NNMT protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NNMT-3779HCL | Recombinant Human NNMT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NNMT Products
Required fields are marked with *
My Review for All NNMT Products
Required fields are marked with *
0
Inquiry Basket