"NNMT" Related Products

Expand
Expand

Recombinant Human NNMT protein, His-tagged

Cat.No.: NNMT-218H
Product Overview: Recombinant mature human NNMT cDNA (264 aa) fused with human Alpha-Fetal Protein N-terminal domain (AFPn)-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: His
Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, Sucrose and DTT.
AA Sequence: MTLHRNEYGIASILDSYQCTAEISLADLATIFFAQFVQEATYKEVSKMVKDALTAIEKPTGDEQSSGCLENQLPA FLEELCHEKEILEKYGHSDCCSQSEEGRHNCFLAHKKPTPASIPLFQVPEPVTSCEAYEEDRETFMNKFIYEIAR RHPFLYAPTILLWAARYDKIIPSCCKAENAVECFQTKAATVTKELRESSGGSHHHHHHGSENLYFQGEFMESGFT SKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQLLSACESFKEI VVTDYSDQNLQELEKWLKKEPEAFDWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPP ADCVLSTLCLDAACPDLPTYCRALRNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYT IEWFEVISQSYSSTMANNEGLFSLVARKLSRPL
Purity: >90% by SDS-PAGE
Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name: NNMT nicotinamide N-methyltransferase [ Homo sapiens ]
Official Symbol: NNMT
Synonyms: NNMT; nicotinamide N-methyltransferase;
Gene ID: 4837
mRNA Refseq: NM_006169
Protein Refseq: NP_006160
MIM: 600008
UniProt ID: P40261
Chromosome Location: 11q23.1
Pathway: Biological oxidations, organism-specific biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Methylation, organism-specific biosystem; Nicotinate and nicotinamide metabolism, organism-specific biosystem; Nicotinate and nicotinamide metabolism, conserved biosystem; Phase II conjugation, organism-specific biosystem;
Function: methyltransferase activity; nicotinamide N-methyltransferase activity; transferase activity;

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.