Recombinant Human NOG, StrepII-tagged
Cat.No. : | NOG-223H |
Product Overview : | Purified, full-length human recombinant Noggin (NOG) protein (amino acids 28-232, 205 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 23 kDa. (Accession NP_005441.1; UniProt Q13253) |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Strep II |
Protein Length : | 28-232, 205 a.a. |
Description : | NOG binds and inactivates members of the transforming growth factor-beta (TGF-beta) superfamily signaling proteins, such as bone morphogenetic protein-4 (BMP4). It is a member of noggin family. |
Form : | Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free). |
AA Sequence : | QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLA ELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGS CFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC |
Endotoxin : | <0.1 eu per ug protein by lal |
Purity : | >95% pure by SDS-PAGE |
Storage : | 12 months at -20°C as supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles. |
Reconstitution : | Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml. |
Gene Name | NOG noggin [ Homo sapiens ] |
Official Symbol | NOG |
Synonyms | NOG; noggin; SYM1, symphalangism 1 (proximal) , synostoses (multiple) syndrome 1 , SYNS1; symphalangism 1 (proximal); SYM1; SYNS1; |
Gene ID | 9241 |
mRNA Refseq | NM_005450 |
Protein Refseq | NP_005441 |
MIM | 602991 |
UniProt ID | Q13253 |
Chromosome Location | 17q22 |
Pathway | BMP receptor signaling, organism-specific biosystem; Signal Transduction, organism-specific biosystem; Signaling by BMP, organism-specific biosystem; TGF Beta Signaling Pathway, organism-specific biosystem; TGF-beta signaling pathway, organism-specific biosystem; TGF-beta signaling pathway, conserved biosystem; |
Function | cytokine binding; protein complex binding; protein homodimerization activity; |
◆ Recombinant Proteins | ||
NOG-2745H | Active Recombinant Human Noggin | +Inquiry |
NOG-3827H | Recombinant Human NOG protein, Fc-tagged, For Organoid Culture | +Inquiry |
NOG-2850H | Recombinant Human NOG protein(28-232 aa), N-MBP & C-His-tagged | +Inquiry |
NOG-3367H | Recombinant Human NOG Protein (Gln28-Cys232), His tagged | +Inquiry |
NOG-42H | Active Recombinant Human NOG Protein, Animal Free | +Inquiry |
◆ Cell & Tissue Lysates | ||
NOG-2414HCL | Recombinant Human NOG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NOG Products
Required fields are marked with *
My Review for All NOG Products
Required fields are marked with *
0
Inquiry Basket