Recombinant Human PAPPA, StrepII-tagged
Cat.No. : | PAPPA-226H |
Product Overview : | Purified, full-length human recombinant Pappalysin-1 preproprotein or PAPPA protein (amino acids 82-621, 540 a.a.) with StrepII tag, produced in human cells. Predicted molecular weight: 60.8 kDa. (Accession NP_002572; UniProt Q13219) |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Human Cells |
Tag : | Strep II |
Protein Length : | 82-621, 540 a.a. |
Description : | PAPPA is a metalloproteinase which cleaves insulin-like growth factor binding proteins (IGFBPs). It is thought to be involved in local proliferative processes such as wound healing and bone remodeling. Low plasma level of this protein has been suggested as a biochemical marker for pregnancies with aneuploid fetuses. It belongs to the peptidase M43B family. Contains 5 Sushi (CCP/SCR) domains. |
Form : | Lyophilized from sterile 0.2μm filtered solution in 0.3X PBS with 10% Trehalose (carrier-free). |
AA Sequence : | EARGATEEPSPPSRALYFSGRGEQLRLRADLELPRDAFTLQVWLRAEGGQRSPAVITGLYDKCSYISRDRGWVVG IHTISDQDNKDPRYFFSLKTDRARQVTTINAHRSYLPGQWVYLAATYDGQFMKLYVNGAQVATSGEQVGGIFSPL TQKCKVLMLGGSALNHNYRGYIEHFSLWKVARTQREILSDMETHGAHTALPQLLLQENWDNVKHAWSPMKDGSSP KVEFSNAHGFLLDTSLEPPLCGQTLCDNTEVIASYNQLSSFRQPKVVRYRVVNLYEDDHKNPTVTREQVDFQHHQ LAEAFKQYNISWELDVLEVSNSSLRRRLILANCDISKIGDENCDPECNHTLTGHDGGDCRHLRHPAFVKKQHNGV CDMDCNYERFNFDGGECCDPEITNVTQTCFDPDSPHRAYLDVNELKNILKLDGSTHLNIFFAKSSEEELAGVATW PWDKEALMHLGGIVLNPSFYGMPGHTHTMIHEIGHSLGLYHVFRGISEIQSCSDPCMETEPSFETGDLCNDTNPA PKHKSCGDPGPGNDT |
Endotoxin : | <0.1 eu per ug protein by lal |
Purity : | >95% pure by SDS-PAGE |
Storage : | 12 months at -20°Cas supplied; 1 month at 4°C after reconstitution. Avoid freeze/thaw cycles. |
Reconstitution : | Centrifuge the vial prior to opening. Reconstitute in PBS to a concentration of 0.1 mg/ml. |
Gene Name | PAPPA pregnancy-associated plasma protein A, pappalysin 1 [ Homo sapiens ] |
Official Symbol | PAPPA |
Synonyms | PAPPA; pregnancy-associated plasma protein A, pappalysin 1; pappalysin-1; ASBABP2; aspecific BCL2 ARE binding protein 2; differentially placenta 1 expressed protein; DIPLA1; IGFBP 4ase; insulin like growth factor dependent IGF binding protein 4 protease; PAPA; PAPP A; PAPPA1; IGF-dependent IGFBP-4 protease; aspecific BCL2 ARE-binding protein 2; pregnacy-associated plasma protein A; insulin-like growth factor-dependent IGF binding protein-4 protease; insulin-like growth factor-dependent IGF-binding protein 4 protease; PAPP-A; IGFBP-4ase; |
Gene ID | 5069 |
mRNA Refseq | NM_002581 |
Protein Refseq | NP_002572 |
MIM | 176385 |
UniProt ID | Q13219 |
Chromosome Location | 9q33.1 |
Pathway | Diabetes pathways, organism-specific biosystem; Disease, organism-specific biosystem; Regulation of Insulin-like Growth Factor (IGF) Activity by Insulin-like Growth Factor Binding Proteins (IGFBPs), organism-specific biosystem; |
Function | endopeptidase activity; metal ion binding; metallopeptidase activity; metallopeptidase activity; peptidase activity; zinc ion binding; |
◆ Recombinant Proteins | ||
PAPPA-226H | Recombinant Human PAPPA, StrepII-tagged | +Inquiry |
PAPPA-28235TH | Recombinant Human PAPPA | +Inquiry |
PAPPA-7722H | Recombinant Human PAPPA protein, His-tagged | +Inquiry |
PAPPA-1798HFL | Recombinant Full Length Human PAPPA Protein, C-Flag-tagged | +Inquiry |
PAPPA-28662TH | Recombinant Human PAPPA, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PAPPA Products
Required fields are marked with *
My Review for All PAPPA Products
Required fields are marked with *
0
Inquiry Basket