Recombinant Human PAX3, GST-tagged
Cat.No. : | PAX3-29056TH |
Product Overview : | Recombinant Human PAX3 (1 a.a. - 484 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene is a member of the paired box (PAX) family of transcription factors. Members of the PAX family typically contain a paired box domain and a paired-type homeodomain. These genes play critical roles during fetal development. Mutations in paired box gene 3 are associated with Waardenburg syndrome, craniofacial-deafness-hand syndrome, and alveolar rhabdomyosarcoma. The translocation t(2;13)(q35;q14), which represents a fusion between PAX3 and the forkhead gene, is a frequent finding in alveolar rhabdomyosarcoma. Alternative splicing results in transcripts encoding isoforms with different C-termini. |
Molecular Mass : | 79.9 kDa |
AA Sequence : | MTTLAGAVPRMMRPGPGQNYPRSGFPLEVSTPLGQGRVNQLGGVFINGRPLPNHIRHKIVEMAHHGIRPCVISRQ LRVSHGCVSKILCRYQETGSIRPGAIGGSKPKQVTTPDVEKKIEEYKRENPGMFSWEIRDKLLKDAVCDRNTVPS VSSISRILRSKFGKGEEEEADLERKEAEESEKKAKHSIDGILSERASAPQSDEGSDIDSEPDLPLKRKQRRSRTT FTAEQLEELERAFERTHYPDIYTREELAQRAKLTEARVQVWFSNRRARWRKQAGANQLMAFNHLIPGGFPPTAMP TLPTYQLSETSYQPTSIPQAVSDPSSTVHRPQPLPPSTVHQSTIPSNPDSSSAYCLPSTRHGFSSYTDSFVPPSG PSNPMNPTIGNGLSPQVMGLLTNHGGVPHQPQTDYALSPLTGGLEPTTTVSASCSQRLDHMKSLDSLPTSQSYCP PTYSTTGYSMDPVTGYQYGQYGQSAFHYLKPDIA |
Applications : | ELISA; WB-Re; AP; Array |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | PAX3 paired box 3 [ Homo sapiens (human) ] |
Official Symbol | PAX3 |
Synonyms | PAX3; WS1; WS3; CDHS; HUP2; paired box 3; paired box protein Pax-3; paired domain gene 3; paired domain gene HuP2; paired box homeotic gene 3 |
Gene ID | 5077 |
mRNA Refseq | NM_181458 |
Protein Refseq | NP_852123 |
MIM | 606597 |
UniProt ID | P23760 |
Chromosome Location | 2q35 |
Pathway | Neural Crest Differentiation; Regulation of retinoblastoma protein; Transcriptional misregulation in cancer |
Function | HMG box domain binding; RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activity; chromatin binding |
◆ Recombinant Proteins | ||
PAX3-7021HF | Recombinant Full Length Human PAX3 Protein, GST-tagged | +Inquiry |
PAX3-29056TH | Recombinant Human PAX3, GST-tagged | +Inquiry |
PAX3-3801H | Recombinant Human PAX3 Protein, His (Fc)-Avi-tagged | +Inquiry |
PAX3-6517M | Recombinant Mouse PAX3 Protein, His (Fc)-Avi-tagged | +Inquiry |
PAX3-12392M | Recombinant Mouse PAX3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PAX3-3418HCL | Recombinant Human PAX3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PAX3 Products
Required fields are marked with *
My Review for All PAX3 Products
Required fields are marked with *
0
Inquiry Basket