Recombinant Human PDIA6, His-tagged
Cat.No. : | PDIA6-124H |
Product Overview : | Recombinant Human Protein Disulfide-Isomerase A6/PDIA6 produced by transfected human cells is a secreted protein with sequence (Leu20-Leu440) of human PDIA6 fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 20-440 a.a. |
Description : | Protein disulfide isomerases (EC 5.3.4.1), such as PDIA6, are endoplasmic reticulum (ER) resident proteins that catalyze formation, reduction, and isomerization of disulfide bonds in proteins and are thought to play a role in folding of disulfide-bonded proteins |
Form : | Supplied as a 0.2 μM filtered solution of 20mM Tris-HCl, 150mM NaCl, 10% Glycerol, pH 8.0 |
AA Sequence : | LYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVKVGAVDAD KHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKDRLGGRSGGYSSG KQGRSDSSSKKDVIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVKEQTKGK VKLAAVDATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIVSRALDLFSD |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. |
Storage : | Store at< -20°c,="" stable="" for="" 6="" months="" after="" receipt.="" please="" minimize="" freeze-thaw=""> |
Gene Name | PDIA6 protein disulfide isomerase family A, member 6 [ Homo sapiens(human) ] |
Official Symbol | PDIA6 |
Synonyms | PDIA6; P5; ERP5; TXNDC7; protein disulfide isomerase family A, member 6; protein disulfide-isomerase A6; ER protein 5; protein disulfide isomerase P5; endoplasmic reticulum protein 5; thioredoxin domain-containing protein 7; protein disulfide isomerase-associated 6; protein disulfide isomerase-related protein; thioredoxin domain containing 7 (protein disulfide isomerase); EC 5.3.4.1 |
Gene ID | 10130 |
mRNA Refseq | NM_005742 |
Protein Refseq | NP_005733 |
MIM | 611099 |
UniProt ID | Q15084 |
Chromosome Location | 2p25.1 |
Pathway | Activation of Chaperone Genes by XBP1(S); Activation of Chaperones by IRE1alpha; Protein processing in endoplasmic reticulum |
Function | electron carrier activity; protein binding; protein disulfide isomerase activity |
◆ Recombinant Proteins | ||
PDIA6-4007R | Recombinant Rat PDIA6 Protein, His (Fc)-Avi-tagged | +Inquiry |
PDIA6-7426HFL | Recombinant Full Length Human PDIA6, Flag-tagged | +Inquiry |
PDIA6-2239H | Recombinant Human PDIA6 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
PDIA6-3177R | Recombinant Rhesus Macaque PDIA6 Protein, His (Fc)-Avi-tagged | +Inquiry |
PDIA6-2856H | Recombinant Human PDIA6, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PDIA6-3330HCL | Recombinant Human PDIA6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PDIA6 Products
Required fields are marked with *
My Review for All PDIA6 Products
Required fields are marked with *
0
Inquiry Basket