Recombinant Human PDIA6, His-tagged

Cat.No. : PDIA6-124H
Product Overview : Recombinant Human Protein Disulfide-Isomerase A6/PDIA6 produced by transfected human cells is a secreted protein with sequence (Leu20-Leu440) of human PDIA6 fused with a polyhistidine tag at the C-terminus.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : His
Protein Length : 20-440 a.a.
Description : Protein disulfide isomerases (EC 5.3.4.1), such as PDIA6, are endoplasmic reticulum (ER) resident proteins that catalyze formation, reduction, and isomerization of disulfide bonds in proteins and are thought to play a role in folding of disulfide-bonded proteins
Form : Supplied as a 0.2 μM filtered solution of 20mM Tris-HCl, 150mM NaCl, 10% Glycerol, pH 8.0
AA Sequence : LYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDVVKVGAVDAD KHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKDRLGGRSGGYSSG KQGRSDSSSKKDVIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVKEQTKGK VKLAAVDATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIVSRALDLFSD
Endotoxin : Less than 0.1 ng/μg (1 IEU/μg).
Purity : Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
Storage : Store at< -20°c,="" stable="" for="" 6="" months="" after="" receipt.="" please="" minimize="" freeze-thaw="">
Gene Name PDIA6 protein disulfide isomerase family A, member 6 [ Homo sapiens(human) ]
Official Symbol PDIA6
Synonyms PDIA6; P5; ERP5; TXNDC7; protein disulfide isomerase family A, member 6; protein disulfide-isomerase A6; ER protein 5; protein disulfide isomerase P5; endoplasmic reticulum protein 5; thioredoxin domain-containing protein 7; protein disulfide isomerase-associated 6; protein disulfide isomerase-related protein; thioredoxin domain containing 7 (protein disulfide isomerase); EC 5.3.4.1
Gene ID 10130
mRNA Refseq NM_005742
Protein Refseq NP_005733
MIM 611099
UniProt ID Q15084
Chromosome Location 2p25.1
Pathway Activation of Chaperone Genes by XBP1(S); Activation of Chaperones by IRE1alpha; Protein processing in endoplasmic reticulum
Function electron carrier activity; protein binding; protein disulfide isomerase activity

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PDIA6 Products

Required fields are marked with *

My Review for All PDIA6 Products

Required fields are marked with *

0
cart-icon