Recombinant Human PFDN5, His-tagged
Cat.No. : | PFDN5-28100TH |
Product Overview : | Recombinant full length Human PFDN5 with N terminal His tag; 174 amino acids with tag, Predicted MWt 19.5 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 154 amino acids |
Description : | This gene encodes a member of the prefoldin alpha subunit family. The encoded protein is one of six subunits of prefoldin, a molecular chaperone complex that binds and stabilizes newly synthesized polypeptides, thereby allowing them to fold correctly. The complex, consisting of two alpha and four beta subunits, forms a double beta barrel assembly with six protruding coiled-coils. The encoded protein may also repress the transcriptional activity of the proto-oncogene c-Myc. Alternatively spliced transcript variants encoding different isoforms have been described. |
Conjugation : | HIS |
Molecular Weight : | 19.500kDa inclusive of tags |
Tissue specificity : | Highly expressed in pancreas and skeletal muscle and moderately in other tissues. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 0.03% DTT, 10% Glycerol |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMAQSINITELNLPQLEMLKN QLDQEVEFLSTSIAQLKVVQTKYVEAKDCLNVLNKSNE GKELLVPLTSSMYVPGKLHDVEHVLIDVGTGYYVEKTAED AKDFFKRKIDFLTKQMEKIQPALQEKHAMKQAVMEMMS QKIQQLTALGAAQATAKA |
Sequence Similarities : | Belongs to the prefoldin subunit alpha family. |
Gene Name | PFDN5 prefoldin subunit 5 [ Homo sapiens ] |
Official Symbol | PFDN5 |
Synonyms | PFDN5; prefoldin subunit 5; prefoldin 5; MM 1; PFD5; |
Gene ID | 5204 |
mRNA Refseq | NM_002624 |
Protein Refseq | NP_002615 |
MIM | 604899 |
Uniprot ID | Q99471 |
Chromosome Location | 12q13.13 |
Pathway | Chaperonin-mediated protein folding, organism-specific biosystem; Cooperation of Prefoldin and TriC/CCTin actin and tubulin folding, organism-specific biosystem; Metabolism of proteins, organism-specific biosystem; Prefoldin mediated transfer of substrateto CCT/TriC, organism-specific biosystem; Protein folding, organism-specific biosystem; |
Function | protein binding; transcription corepressor activity; unfolded protein binding; |
◆ Recombinant Proteins | ||
PFDN5-29723TH | Recombinant Human PFDN5, His-tagged | +Inquiry |
PFDN5-6652M | Recombinant Mouse PFDN5 Protein, His (Fc)-Avi-tagged | +Inquiry |
PFDN5-28100TH | Recombinant Human PFDN5, His-tagged | +Inquiry |
PFDN5-2580H | Recombinant Human PFDN5 Protein, His-tagged | +Inquiry |
PFDN5-6248Z | Recombinant Zebrafish PFDN5 | +Inquiry |
◆ Cell & Tissue Lysates | ||
PFDN5-3278HCL | Recombinant Human PFDN5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PFDN5 Products
Required fields are marked with *
My Review for All PFDN5 Products
Required fields are marked with *