"PHPT1" Related Products

Expand
Expand

Recombinant Human PHPT1 Protein (1-125 aa), His-tagged

Cat.No.: PHPT1-1482H
Product Overview: Recombinant Human PHPT1 Protein (1-125 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cell Biology. Protein Description: Full Length.
Description: Exhibits phosphohistidine phosphatase activity.
Source: Yeast
Species: Human
Tag : His
Form: Tris-based buffer,50% glycerol
Molecular Mass: 15.8 kDa
Protein length: 1-125 aa
AA Sequence: MAVADLALIPDVDIDSDGVFKYVLIRVHSAPRSGAPAAESKEIVRGYKWAEYHADIYDKVSGDMQKQGCDCECLGGGRISHQSQDKKIHVYGYSMAYGPAQHAISTEKIKAKYPDYEVTWANDGY
Purity: > 90% as determined by SDS-PAGE.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.
Gene Name: PHPT1 phosphohistidine phosphatase 1 [ Homo sapiens ]
Official Symbol: PHPT1
Synonyms: PHPT1; PHP14; 1700008C22Rik; CGI-202; RP11-216L13.10;
Gene ID: 29085
mRNA Refseq: NM_001135861
Protein Refseq: NP_001129333
MIM: 610167
UniProt ID: Q9NRX4

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.