Recombinant Human PLA2G1B Protein

• Cat.No.: PLA2G1B-832H
• Product Overview: Recombinant human PLA2G1B protein without tag was expressed in HEK293.

Specification

• Species: Human
• Source: HEK293
• Protein Length: 148
• Description: This gene encodes a secreted member of the phospholipase A2 (PLA2) class of enzymes, which is produced by the pancreatic acinar cells. The encoded calcium-dependent enzyme catalyzes the hydrolysis of the sn-2 position of membrane glycerophospholipids to release arachidonic acid (AA) and lysophospholipids. AA is subsequently converted by downstream metabolic enzymes to several bioactive lipophilic compounds (eicosanoids), including prostaglandins (PGs) and leukotrienes (LTs). The enzyme may be involved in several physiological processes including cell contraction, cell proliferation and pathological response.
• Form: Lyophilized
• Molecular Mass: 15 kDa
• AA Sequence: MKLLVLAVLLTVAAADSGISPRAVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPVDELDKCCQTHDNCYDQAKKLDSCKFLLDNPYTHTYSYSCSGSAITCSSKNKECEAFICNCDRNAAICFSKAPYNKAHKNLDTKKYCQS
• Purity: > 98%
• Applications: Migration Assay; WB; Biochemical Assay
• Stability: This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
• Storage: At -20 centigrade.
• Concentration: 1 mg/mL
• Storage Buffer: PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
• Reconstitution: Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.

Gene Information

• Gene Name: PLA2G1B phospholipase A2, group IB (pancreas) [ Homo sapiens (human) ]
• Official Symbol: PLA2G1B
• Synonyms: PLA2G1B; phospholipase A2, group IB (pancreas); PLA2, PLA2A, PPLA2; phospholipase A2; group IB phospholipase A2; phosphatidylcholine 2-acylhydrolase 1B; PLA2; PLA2A; PPLA2; MGC119834; MGC119835
• Gene ID: 5319
• mRNA Refseq: NM_000928
• Protein Refseq: NP_000919
• MIM: 172410
• UniProt ID: P04054