Recombinant Human PLA2G1B Protein

Cat.No. : PLA2G1B-832H
Product Overview : Recombinant human PLA2G1B protein without tag was expressed in HEK293.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Protein Length : 148
Description : This gene encodes a secreted member of the phospholipase A2 (PLA2) class of enzymes, which is produced by the pancreatic acinar cells. The encoded calcium-dependent enzyme catalyzes the hydrolysis of the sn-2 position of membrane glycerophospholipids to release arachidonic acid (AA) and lysophospholipids. AA is subsequently converted by downstream metabolic enzymes to several bioactive lipophilic compounds (eicosanoids), including prostaglandins (PGs) and leukotrienes (LTs). The enzyme may be involved in several physiological processes including cell contraction, cell proliferation and pathological response.
Form : Lyophilized
Molecular Mass : 15 kDa
AA Sequence : MKLLVLAVLLTVAAADSGISPRAVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPVDELDKCCQTHDNCYDQAKKLDSCKFLLDNPYTHTYSYSCSGSAITCSSKNKECEAFICNCDRNAAICFSKAPYNKAHKNLDTKKYCQS
Purity : > 98%
Applications : Migration Assay; WB; Biochemical Assay;
Stability : This bioreagent is stable at 4 centigrade (short-term) and -70 centigrade(long-term). After reconstitution, sample may be stored at 4 centigrade for 2-7 days and below -18 centigrade for future use.
Storage : At -20 centigrade.
Concentration : 1 mg/mL
Storage Buffer : PBS (pH 7.4-7.5). Sterile-filtered colorless solution.
Reconstitution : Reconstitute in sterile distilled H2O to no less than 100 μg/mL; dilute reconstituted stock further in other aqueous solutions if needed. Please review COA for lot-specific instructions. Final measurements should be determined by the end-user for optimal performance.
Gene Name PLA2G1B phospholipase A2, group IB (pancreas) [ Homo sapiens (human) ]
Official Symbol PLA2G1B
Synonyms PLA2G1B; phospholipase A2, group IB (pancreas); PLA2, PLA2A, PPLA2; phospholipase A2; group IB phospholipase A2; phosphatidylcholine 2-acylhydrolase 1B; PLA2; PLA2A; PPLA2; MGC119834; MGC119835;
Gene ID 5319
mRNA Refseq NM_000928
Protein Refseq NP_000919
MIM 172410
UniProt ID P04054

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PLA2G1B Products

Required fields are marked with *

My Review for All PLA2G1B Products

Required fields are marked with *

0
cart-icon
0
compare icon