Recombinant Human PNPLA6, His-tagged

• Cat.No.: PNPLA6-29926TH
• Product Overview: Recombinant fragment, corresponding to amino acids 1132-1366 of Human NTE with an N terminal His tag; Predicted MWt 27 kDa.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1132-1366 a.a.
• Description: This gene encodes a phospholipase that deacetylates intracellular phosphatidylcholine to produce glycerophosphocholine. It is thought to function in neurite outgrowth and process elongation during neuronal differentiation. The protein is anchored to the cytoplasmic face of the endoplasmic reticulum in both neurons and non-neuronal cells. Mutations in this gene result in autosomal recessive spastic paraplegia, and the protein is the target for neurodegeneration induced by organophosphorus compounds and chemical warfare agents. Multiple transcript variants encoding different isoforms have been found for this gene.
• Conjugation: HIS
• Tissue specificity: Expressed in brain, placenta, kidney, neuron and skeletal muscle.
• Form: Lyophilised:Reconstitute with 108 μl aqua dest.
• Storage buffer: Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: LPADIARSMGAKTVIAIDVGSQDETDLSTYGDSLSGWWLL WKRLNPWADKVKVPDMAEIQSRLAYVSCVRQLEVVKSS SYCEYLRPPIDCFKTMDFGKFDQIYDVGYQYGKAVFGG WSRGNVIEKMLTDRRSTDLNESRRADVLAFPSSGFTDL AEIVSRIEPPTSYVSDGCADGEESDCLTEYEEDAGPDCSR DEGGSPEGASPSTASEMEEEKSILRQRRCLPQEPPGSA TDA
• Sequence Similarities: Belongs to the NTE family.Contains 3 cyclic nucleotide-binding domains.Contains 1 patatin domain.

Gene Information

• Gene Name: PNPLA6 patatin-like phospholipase domain containing 6 [ Homo sapiens ]
• Official Symbol: PNPLA6
• Synonyms: PNPLA6; patatin-like phospholipase domain containing 6; neuropathy target esterase; NTE; sws
• Gene ID: 10908
• mRNA Refseq: NM_001166114
• Protein Refseq: NP_001159586
• MIM: 603197
• Uniprot ID: Q8IY17
• Chromosome Location: 19p13.2
• Pathway: Glycerophospholipid metabolism, organism-specific biosystem; Glycerophospholipid metabolism, conserved biosystem
• Function: hydrolase activity; lysophospholipase activity