Recombinant Human PNPLA6, His-tagged

Cat.No. : PNPLA6-29926TH
Product Overview : Recombinant fragment, corresponding to amino acids 1132-1366 of Human NTE with an N terminal His tag; Predicted MWt 27 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1132-1366 a.a.
Description : This gene encodes a phospholipase that deacetylates intracellular phosphatidylcholine to produce glycerophosphocholine. It is thought to function in neurite outgrowth and process elongation during neuronal differentiation. The protein is anchored to the cytoplasmic face of the endoplasmic reticulum in both neurons and non-neuronal cells. Mutations in this gene result in autosomal recessive spastic paraplegia, and the protein is the target for neurodegeneration induced by organophosphorus compounds and chemical warfare agents. Multiple transcript variants encoding different isoforms have been found for this gene.
Conjugation : HIS
Tissue specificity : Expressed in brain, placenta, kidney, neuron and skeletal muscle.
Form : Lyophilised:Reconstitute with 108 μl aqua dest.
Storage buffer : Preservative: NoneConstituents: 0.5% Trehalose, 6M Urea, 100mM Sodium phosphate, 10mM Sodium chloride, pH 4.5
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : LPADIARSMGAKTVIAIDVGSQDETDLSTYGDSLSGWWLL WKRLNPWADKVKVPDMAEIQSRLAYVSCVRQLEVVKSS SYCEYLRPPIDCFKTMDFGKFDQIYDVGYQYGKAVFGG WSRGNVIEKMLTDRRSTDLNESRRADVLAFPSSGFTDL AEIVSRIEPPTSYVSDGCADGEESDCLTEYEEDAGPDCSR DEGGSPEGASPSTASEMEEEKSILRQRRCLPQEPPGSA TDA
Sequence Similarities : Belongs to the NTE family.Contains 3 cyclic nucleotide-binding domains.Contains 1 patatin domain.
Gene Name PNPLA6 patatin-like phospholipase domain containing 6 [ Homo sapiens ]
Official Symbol PNPLA6
Synonyms PNPLA6; patatin-like phospholipase domain containing 6; neuropathy target esterase; NTE; sws;
Gene ID 10908
mRNA Refseq NM_001166114
Protein Refseq NP_001159586
MIM 603197
Uniprot ID Q8IY17
Chromosome Location 19p13.2
Pathway Glycerophospholipid metabolism, organism-specific biosystem; Glycerophospholipid metabolism, conserved biosystem;
Function hydrolase activity; lysophospholipase activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PNPLA6 Products

Required fields are marked with *

My Review for All PNPLA6 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon