Recombinant Human PZP Protein (472-821 aa), GST-tagged
Cat.No. : | PZP-1498H |
Product Overview : | Recombinant Human PZP Protein (472-821 aa) is produced by Yeast expression system. This protein is fused with a GST tag at the N-terminal. Research Area: Neuroscience. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | GST |
Protein Length : | 472-821 aa |
Description : | Is able to inhibit all four classes of proteinases by a unique 'trapping' mechanism. This protein has a peptide stretch, called the 'bait region' which contains specific cleavage sites for different proteinases. When a proteinase cleaves the bait region, a conformational change is induced in the protein which traps the proteinase. The entrapped enzyme rains active against low molecular weight substrates (activity against high molecular weight substrates is greatly reduced). Following cleavage in the bait region a thioester bond is hydrolyzed and mediates the covalent binding of the protein to the proteinase. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 65.3 kDa |
AA Sequence : | MKPEAELSVSSVYNLLTVKDLTNFPDNVDQQEEEQGHCPRPFFIHNGAIYVPLSSNEADIYSFLKGMGLKVFTNSKIRKPKSCSVIPSVSAGAVGQGYYGAGLGVVERPYVPQLGTYNVIPLNNEQSSGPVPETVRSYFPETWIWELVAVNSSGVAEVGVTVPDTITEWKAGAFCLSEDAGLGISSTASLRAFQPFFVELTMPYSVIRGEVFTLKATVLNYLPKCIRAEGIEQEKTFSSMTCASGANVSEQLSLKLPSNVVKESARASFSVLGDILGSAMQNIQNLLQMPYGCGEQNMVLFAPNIYVLNYLNETQQLTQEIKAKAVGYLITGYQRQLNYKHQDGSYSTFG |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | PZP PZP alpha-2-macroglobulin like [ Homo sapiens (human) ] |
Official Symbol | PZP |
Synonyms | CPAMD6; |
Gene ID | 5858 |
UniProt ID | P20742 |
◆ Recombinant Proteins | ||
PZP-2089H | Recombinant Human PZP, His-tagged | +Inquiry |
Pzp-450M | Recombinant Mouse Pzp Protein, His/GST-tagged | +Inquiry |
Pzp-452R | Recombinant Rat Pzp Protein, His/GST-tagged | +Inquiry |
PZP-1498H | Recombinant Human PZP Protein (472-821 aa), GST-tagged | +Inquiry |
PZP-3957H | Recombinant Human PZP Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Pzp-3279H | Native Human Pzp | +Inquiry |
A1m-367M | Native Mouse A1m | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PZP Products
Required fields are marked with *
My Review for All PZP Products
Required fields are marked with *
0
Inquiry Basket