Recombinant Human QDPR, His-tagged
Cat.No. : | QDPR-30230TH |
Product Overview : | Recombinant full length Human QDPR with an N terminal His tag; 267 amino acids with the tag; observed mwt: 28.2 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 244 amino acids |
Description : | This gene encodes the enzyme dihydropteridine reductase, which catalyzes the NADH-mediated reduction of quinonoid dihydrobiopterin.This enzyme is an essential component of the pterin-dependent aromatic amino acid hydroxylating systems. Mutations in this gene resulting in QDPR deficiency include aberrant splicing, amino acid substitutions, insertions, or premature terminations.Dihydropteridine reductase deficiency presents as atypical phenylketonuria due to insufficient production of biopterin, a cofactor for phenylalanine hydroxylase. |
Conjugation : | HIS |
Molecular Weight : | 28.200kDa inclusive of tags |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:10% Glycerol, 0.32% Tris HCl, 0.04% DTT |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMGSMAAAAAAGEARRVLVYGGRGALGSRCVQAFRARNWWVASVDVVENEEASASIIVKMTDSFTEQADQVTAEVGKLLGEEKVDAILCVAGGWAGGNAKSKSLFKNCDLMWKQSIWTSTISSHLATKHLKEGGLLTLAGAKAALDGTPGMIGYGMAKGAVHQLCQSLAGKNSGMPPGAAAIAVLPVTLDTPMNRKSMPEADFSSWTPLEFLVETFHDWITGKNRPSSGSLIQVVTTEGRTELTPAYF |
Sequence Similarities : | Belongs to the short-chain dehydrogenases/reductases (SDR) family. |
Gene Name | QDPR quinoid dihydropteridine reductase [ Homo sapiens ] |
Official Symbol | QDPR |
Synonyms | QDPR; quinoid dihydropteridine reductase; dihydropteridine reductase; 6; 7 dihydropteridine reductase; DHPR; PKU2; SDR33C1; short chain dehydrogenase/reductase family 33C; member 1; |
Gene ID | 5860 |
mRNA Refseq | NM_000320 |
Protein Refseq | NP_000311 |
MIM | 612676 |
Uniprot ID | P09417 |
Chromosome Location | 4p15.31 |
Pathway | Folate biosynthesis, organism-specific biosystem; Folate biosynthesis, conserved biosystem; Metabolic pathways, organism-specific biosystem; Metabolism, organism-specific biosystem; Metabolism of amino acids and derivatives, organism-specific biosystem; |
Function | 6,7-dihydropteridine reductase activity; NADH binding; NADPH binding; electron carrier activity; nucleotide binding; |
◆ Recombinant Proteins | ||
Qdpr-471M | Recombinant Mouse Qdpr Protein, MYC/DDK-tagged | +Inquiry |
QDPR-30230TH | Recombinant Human QDPR, His-tagged | +Inquiry |
QDPR-2090H | Recombinant Full Length Human QDPR Protein, His-tagged | +Inquiry |
QDPR-1703C | Recombinant Chicken QDPR | +Inquiry |
QDPR-4522R | Recombinant Rat QDPR Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
QDPR-520HCL | Recombinant Human QDPR lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All QDPR Products
Required fields are marked with *
My Review for All QDPR Products
Required fields are marked with *
0
Inquiry Basket