Recombinant Full Length Human QDPR Protein, GST-tagged
Cat.No. : | QDPR-3732H |
Product Overview : | Recombinant Human QDPR protein(1-244 aa), fused to GST tag, was expressed in E. coli. |
Availability | October 07, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | 1-244 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
AA Sequence : | MAAAAAAGEARRVLVYGGRGALGSRCVQAFRARNWWVASVDVVENEEASASIIVKMTDSFTEQADQVTAEVGKLLGEEKVDAILCVAGGWAGGNAKSKSLFKNCDLMWKQSIWTSTISSHLATKHLKEGGLLTLAGAKAALDGTPGMIGYGMAKGAVHQLCQSLAGKNSGMPPGAAAIAVLPVTLDTPMNRKSMPEADFSSWTPLEFLVETFHDWITGKNRPSSGSLIQVVTTEGRTELTPAYF |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | QDPR quinoid dihydropteridine reductase [ Homo sapiens ] |
Official Symbol | QDPR |
Synonyms | QDPR; quinoid dihydropteridine reductase; dihydropteridine reductase; 6; 7 dihydropteridine reductase; DHPR; PKU2; SDR33C1; short chain dehydrogenase/reductase family 33C; member 1; HDHPR; 6,7-dihydropteridine reductase; short chain dehydrogenase/reductase family 33C, member 1; FLJ42391; |
Gene ID | 5860 |
mRNA Refseq | NM_000320 |
Protein Refseq | NP_000311 |
MIM | 612676 |
UniProt ID | P09417 |
◆ Recombinant Proteins | ||
QDPR-679H | Recombinant Full Length Human QDPR Protein, His-tagged | +Inquiry |
QDPR-4522R | Recombinant Rat QDPR Protein, His (Fc)-Avi-tagged | +Inquiry |
Qdpr-471M | Recombinant Mouse Qdpr Protein, MYC/DDK-tagged | +Inquiry |
QDPR-1703C | Recombinant Chicken QDPR | +Inquiry |
QDPR-30230TH | Recombinant Human QDPR, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
QDPR-520HCL | Recombinant Human QDPR lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All QDPR Products
Required fields are marked with *
My Review for All QDPR Products
Required fields are marked with *