Recombinant Full Length Human QDPR Protein, GST-tagged

Cat.No. : QDPR-3732H
Product Overview : Recombinant Human QDPR protein(1-244 aa), fused to GST tag, was expressed in E. coli.
Availability July 04, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-244 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
AA Sequence : MAAAAAAGEARRVLVYGGRGALGSRCVQAFRARNWWVASVDVVENEEASASIIVKMTDSFTEQADQVTAEVGKLLGEEKVDAILCVAGGWAGGNAKSKSLFKNCDLMWKQSIWTSTISSHLATKHLKEGGLLTLAGAKAALDGTPGMIGYGMAKGAVHQLCQSLAGKNSGMPPGAAAIAVLPVTLDTPMNRKSMPEADFSSWTPLEFLVETFHDWITGKNRPSSGSLIQVVTTEGRTELTPAYF
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks).
Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.
Gene Name QDPR quinoid dihydropteridine reductase [ Homo sapiens ]
Official Symbol QDPR
Synonyms QDPR; quinoid dihydropteridine reductase; dihydropteridine reductase; 6; 7 dihydropteridine reductase; DHPR; PKU2; SDR33C1; short chain dehydrogenase/reductase family 33C; member 1; HDHPR; 6,7-dihydropteridine reductase; short chain dehydrogenase/reductase family 33C, member 1; FLJ42391;
Gene ID 5860
mRNA Refseq NM_000320
Protein Refseq NP_000311
MIM 612676
UniProt ID P09417

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All QDPR Products

Required fields are marked with *

My Review for All QDPR Products

Required fields are marked with *

0
cart-icon