Recombinant Full Length Human QDPR Protein, GST-tagged

• Cat.No.: QDPR-3732H
• Product Overview: Recombinant Human QDPR protein(1-244 aa), fused to GST tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: GST
• Protein Length: 1-244 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• AA Sequence: MAAAAAAGEARRVLVYGGRGALGSRCVQAFRARNWWVASVDVVENEEASASIIVKMTDSFTEQADQVTAEVGKLLGEEKVDAILCVAGGWAGGNAKSKSLFKNCDLMWKQSIWTSTISSHLATKHLKEGGLLTLAGAKAALDGTPGMIGYGMAKGAVHQLCQSLAGKNSGMPPGAAAIAVLPVTLDTPMNRKSMPEADFSSWTPLEFLVETFHDWITGKNRPSSGSLIQVVTTEGRTELTPAYF
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: QDPR quinoid dihydropteridine reductase [ Homo sapiens ]
• Official Symbol: QDPR
• Synonyms: QDPR; quinoid dihydropteridine reductase; dihydropteridine reductase; 6; 7 dihydropteridine reductase; DHPR; PKU2; SDR33C1; short chain dehydrogenase/reductase family 33C; member 1; HDHPR; 6,7-dihydropteridine reductase; short chain dehydrogenase/reductase family 33C, member 1; FLJ42391
• Gene ID: 5860
• mRNA Refseq: NM_000320
• Protein Refseq: NP_000311
• MIM: 612676
• UniProt ID: P09417