Recombinant Human RAB5A protein, GST-tagged
Cat.No. : | RAB5A-301493H |
Product Overview : | Recombinant Human RAB5A (1-215 aa) protein, fused to GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST |
Protein Length : | Met1-Asn215 |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
AA Sequence : | MASRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCSN |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Stability : | Store for up to 12 months at -20°C to -80°C as lyophilized powder. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Gene Name | RAB5A RAB5A, member RAS oncogene family [ Homo sapiens ] |
Official Symbol | RAB5A |
Synonyms | RAB5A; RAB5A, member RAS oncogene family; RAB5; ras-related protein Rab-5A; RAS associated protein RAB5A; RAS-associated protein RAB5A; |
Gene ID | 5868 |
mRNA Refseq | NM_004162 |
Protein Refseq | NP_004153 |
MIM | 179512 |
UniProt ID | P20339 |
◆ Recombinant Proteins | ||
Rab5a-1115R | Active Recombinant Rat RAB5A, Member RAS Oncogene Family | +Inquiry |
RAB5A-374H | Recombinant Full Length Human RAB5A Protein, Untagged | +Inquiry |
RAB5A-6132H | Recombinant Human RAB5A Protein (Asp136-Asn215), N-His tagged | +Inquiry |
RAB5A-859HFL | Recombinant Full Length Human RAB5A Protein, C-Flag-tagged | +Inquiry |
RAB5A-13834M | Recombinant Mouse RAB5A Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
RAB5A-2588HCL | Recombinant Human RAB5A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RAB5A Products
Required fields are marked with *
My Review for All RAB5A Products
Required fields are marked with *