Recombinant Full Length Human RAB5A Protein, C-Flag-tagged
Cat.No. : | RAB5A-859HFL |
Product Overview : | Recombinant Full Length Human RAB5A Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Enables GDP binding activity; GTP binding activity; and GTPase activity. Involved in several processes, including amyloid-beta clearance by transcytosis; early endosome to late endosome transport; and regulation of exocytosis. Located in several cellular components, including cytoplasmic side of early endosome membrane; nucleoplasm; and terminal bouton. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 23.5 kDa |
AA Sequence : | MASRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVK FEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANK RAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRN QCCSNTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Amyotrophic lateral sclerosis (ALS), Endocytosis |
Full Length : | Full L. |
Gene Name | RAB5A RAB5A, member RAS oncogene family [ Homo sapiens (human) ] |
Official Symbol | RAB5A |
Synonyms | RAB5 |
Gene ID | 5868 |
mRNA Refseq | NM_004162.5 |
Protein Refseq | NP_004153.2 |
MIM | 179512 |
UniProt ID | P20339 |
◆ Recombinant Proteins | ||
RAB5A-838C | Recombinant Cynomolgus RAB5A Protein, His-tagged | +Inquiry |
RAB5A-7996H | Recombinant Human RAB5A protein, His-tagged | +Inquiry |
RAB5A-1838H | Recombinant Human RAB5A Protein, His (Fc)-Avi-tagged | +Inquiry |
RAB5A-3756R | Recombinant Rhesus monkey RAB5A Protein, His-tagged | +Inquiry |
Rab5a-1115R | Active Recombinant Rat RAB5A, Member RAS Oncogene Family | +Inquiry |
◆ Cell & Tissue Lysates | ||
RAB5A-2588HCL | Recombinant Human RAB5A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RAB5A Products
Required fields are marked with *
My Review for All RAB5A Products
Required fields are marked with *
0
Inquiry Basket