Recombinant Human RETN Protein
Cat.No. : | RETN-234H |
Product Overview : | Recombinant Human RETN Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Description : | Resistin is a peptide hormone belonging to a class of cysteine-rich secreted proteins, termed the resistin-like molecules (RELM) family. Resistin is produced by macrophages and functions during insulin sensitivity and inflammatory processes. |
Bio-activity : | No biological activity data is available at this time. |
Molecular Mass : | Dimer, 9.9/19.7 kDa (93/186 aa) |
AA Sequence : | MSSKTLCSMEEAINERIQEVAGSLIFRAISSIGLECQSVTSRGDLATCPRGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRVQP |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA) |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | RETN resistin [ Homo sapiens (human) ] |
Official Symbol | RETN |
Synonyms | RETN; resistin; ADSF; FIZZ3; RETN1; resistin delta2; found in inflammatory zone 3; cysteine-rich secreted protein FIZZ3; adipose tissue-specific secretory factor; cysteine-rich secreted protein A12-alpha-like 2; c/EBP-epsilon-regulated myeloid-specific secreted cysteine-rich protein; C/EBP-epsilon regulated myeloid-specific secreted cysteine-rich protein precursor 1; RSTN; XCP1; MGC126603; MGC126609; |
Gene ID | 56729 |
mRNA Refseq | NM_001193374 |
Protein Refseq | NP_001180303 |
MIM | 605565 |
UniProt ID | Q9HD89 |
◆ Recombinant Proteins | ||
RETN-1351C | Recombinant Cattle RETN Protein, His-tagged | +Inquiry |
RETN-012H | Recombinant Human RETN Protein, His-tagged | +Inquiry |
RETN-874M | Recombinant Mouse RETN protein, hFc-tagged | +Inquiry |
Retn-1209R | Recombinant Rat Retn Protein, His-tagged | +Inquiry |
Retn-68M | Recombinant Mouse Resistin, Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RETN-1635MCL | Recombinant Mouse RETN cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RETN Products
Required fields are marked with *
My Review for All RETN Products
Required fields are marked with *
0
Inquiry Basket