Recombinant Human S100A2, His-tagged
Cat.No. : | S100A2-31341TH |
Product Overview : | Recombinant full length Human S100 alpha 2 with an N terminal His tag; 117 amino acids with tag, MWt 13.1 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 97 amino acids |
Description : | The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may have a tumor suppressor function. Chromosomal rearrangements and altered expression of this gene have been implicated in breast cancer. |
Conjugation : | HIS |
Molecular Weight : | 13.100kDa inclusive of tags |
Tissue specificity : | A subset of epithelial cells including normal human mammary epithelial cells and keratinocytes. |
Form : | Liquid |
Purity : | >90% by SDS-PAGE |
Storage buffer : | Preservative: NoneConstituents: 30% Glycerol, 0.2M Sodium chloride, 5mM DTT, 20mM Tris HCl, pH 8.0 |
Storage : | Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMCSSLEQALAVLVTTFHKYSCQEGDKFKLSKGEMKELLHKELPSFVGEKVDEEGLKKLMGSLDENSDQQVDFQEYAVFLALITVMCNDFFQGCPDRP |
Sequence Similarities : | Belongs to the S-100 family.Contains 2 EF-hand domains. |
Gene Name | S100A2 S100 calcium binding protein A2 [ Homo sapiens ] |
Official Symbol | S100A2 |
Synonyms | S100A2; S100 calcium binding protein A2; S100 calcium binding protein A2 , S100L; protein S100-A2; CAN19; |
Gene ID | 6273 |
mRNA Refseq | NM_005978 |
Protein Refseq | NP_005969 |
MIM | 176993 |
Uniprot ID | P29034 |
Chromosome Location | 1q21 |
Pathway | Direct p53 effectors, organism-specific biosystem; |
Function | calcium ion binding; |
◆ Recombinant Proteins | ||
S100A2-230H | Recombinant Human S100A2 Protein, MYC/DDK-tagged | +Inquiry |
S100A2-3811H | Recombinant Human S100A2 protein(Met2-Pro98) | +Inquiry |
S100A2-9855H | Recombinant Human S100A2 protein, His-tagged | +Inquiry |
S100A2-3414H | Recombinant Human S100A2, His-tagged | +Inquiry |
S100A2-31341TH | Recombinant Human S100A2, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
S100A2-2860HCL | Recombinant Human S100A2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All S100A2 Products
Required fields are marked with *
My Review for All S100A2 Products
Required fields are marked with *