"S100A7" Related Products

Expand
Expand

Recombinant Human S100A7 protein, GST-tagged

Cat.No.: S100A7-185H
Product Overview: Recombinant Human S100A7(1 a.a. - 101 a.a.) fused with GST tag at N-terminal was expressed in Wheat Germ.
Description: The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein differs from the other S100 proteins of known structure in its lack of calcium binding ability in one EF-hand at the N-terminus. The protein is overexpressed in hyperproliferative skin diseases, exhibits antimicrobial activities against bacteria and induces immunomodulatory activities.
Source: Wheat Germ
Species: Human
Tag: GST
Form: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass: 36.85 Kd
AA Sequence: MSNTQAERSIIGMIDMFHKYTRRDDKIDKPSLLTMMKENFPNFLSACDKKGTNYLADVFEKKDKNEDKKIDFSEF LSLLGDIATDYHKQSHGAAPCSGGSQ
Applications: Enzyme-linked Immunoabsorbent Assay; Western Blot (Recombinant protein); Antibody Production; Protein Array
Notes: Best use within three months from the date of receipt of this protein.
Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Gene Name: S100A7 S100 calcium binding protein A7 [ Homo sapiens ]
Official Symbol: S100A7
Synonyms: S100A7; S100 calcium binding protein A7; PSOR1, S100 calcium binding protein A7 (psoriasin 1) , S100 calcium binding protein A7 (psoriasin 1); protein S100-A7; S100A7c; psoriasin 1; S100 calcium-binding protein A7 (psoriasin 1); PSOR1;
Gene ID: 6278
mRNA Refseq: NM_002963
Protein Refseq: NP_002954
MIM: 600353
UniProt ID: P31151
Chromosome Location: 1q21
Pathway: Validated targets of C-MYC transcriptional repression, organism-specific biosystem;
Function: RAGE receptor binding; calcium ion binding; protein binding; zinc ion binding; zinc ion binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.