| Species : |
Human |
| Source : |
E.coli |
| Tag : |
His |
| Protein Length : |
19-144 a.a. |
| Description : |
Syndecans are type I integral membrane proteoglycans that contain both chondroitin sulfate and heparan sulfate groups. Syndecans are involved in cell-extracellular matrix adhesion and growth factor binding. Syndecan-1 (SYND1, also called CD138) is anextracellular matrix receptor which binds to collagens, Fibronectin and Thrombospondin. Syndecan-1 and Syndecan-3 (also designated N-Syndecan) interact with MK (midkine), a growth/differentiation factor invloved in embryogenesis of the central nervous system. Syndecan-2 (also designated fibroglycan or HSPG) is highly expressed at areas of high morphogenetic activity, such as epithelial-mesenchymal interfaces and the prechondrogenic and preosteogenic mesenchymal condensations. Syndecan-4 (also designated amphiglycan or ryudocan) functions cooperativley with integrins in the processes of cell spreading, focal adhesion assembly and Actin stress fiber assembly |
| Molecular Mass : |
~14 kDa |
| AA Sequence : |
ESRAELTSDKDMYLDNSSIEEASGVYPIDDDDYASASGSGADEDVESPELTTSRPLPKILLTSAAPKVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERKMDPAEEDTNVYTEKHSDSLFKRTE |
| Purity : |
Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
| Notes : |
For research use only, not for use in diagnostic procedure. |
| Storage : |
Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
| Concentration : |
≥0.5 mg/mL |
| Storage Buffer : |
PBS, 4M Urea, pH7.4 |
