Recombinant Human SDC2 Protein, C-His-tagged
Cat.No. : | SDC2-127H |
Product Overview : | Recombinant Human SDC2 Protein with C-His tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 19-144 a.a. |
Description : | Syndecans are type I integral membrane proteoglycans that contain both chondroitin sulfate and heparan sulfate groups. Syndecans are involved in cell-extracellular matrix adhesion and growth factor binding. Syndecan-1 (SYND1, also called CD138) is anextracellular matrix receptor which binds to collagens, Fibronectin and Thrombospondin. Syndecan-1 and Syndecan-3 (also designated N-Syndecan) interact with MK (midkine), a growth/differentiation factor invloved in embryogenesis of the central nervous system. Syndecan-2 (also designated fibroglycan or HSPG) is highly expressed at areas of high morphogenetic activity, such as epithelial-mesenchymal interfaces and the prechondrogenic and preosteogenic mesenchymal condensations. Syndecan-4 (also designated amphiglycan or ryudocan) functions cooperativley with integrins in the processes of cell spreading, focal adhesion assembly and Actin stress fiber assembly |
Molecular Mass : | ~14 kDa |
AA Sequence : | ESRAELTSDKDMYLDNSSIEEASGVYPIDDDDYASASGSGADEDVESPELTTSRPLPKILLTSAAPKVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERKMDPAEEDTNVYTEKHSDSLFKRTE |
Purity : | Transferred into competent cells and the supernatant was purified by NI column affinity chromatography and the purity is > 85% (by SDS-PAGE). |
Notes : | For research use only, not for use in diagnostic procedure. |
Storage : | Store at 4 centigrade short term. Aliquot and store at -20 centigrade long term. Avoid freeze-thaw cycles. |
Concentration : | ≥0.5 mg/mL |
Storage Buffer : | PBS, 4M Urea, pH7.4 |
Gene Name | SDC2 syndecan 2 [ Homo sapiens (human) ] |
Official Symbol | SDC2 |
Synonyms | SDC2; syndecan 2; heparan sulfate proteoglycan 1, cell surface associated , HSPG, HSPG1; syndecan-2; CD362; fibroglycan; SYND2; syndecan proteoglycan 2; heparan sulfate proteoglycan core protein; cell surface-associated heparan sulfate proteoglycan 1; heparan sulfate proteoglycan 1, cell surface-associated; HSPG; HSPG1; |
Gene ID | 6383 |
mRNA Refseq | NM_002998 |
Protein Refseq | NP_002989 |
MIM | 142460 |
UniProt ID | P34741 |
◆ Recombinant Proteins | ||
SDC2-14790M | Active Recombinant Mouse SDC2 Protein | +Inquiry |
SDC2-2836H | Recombinant Human SDC2 protein, His-tagged | +Inquiry |
SDC2-6249H | Recombinant Human SDC2 Protein (Glu19-Glu144), C-His tagged | +Inquiry |
RFL23033HF | Recombinant Full Length Human Syndecan-2(Sdc2) Protein, His-Tagged | +Inquiry |
Sdc2-2766M | Recombinant Mouse Sdc2 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SDC2-1575HCL | Recombinant Human SDC2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SDC2 Products
Required fields are marked with *
My Review for All SDC2 Products
Required fields are marked with *
0
Inquiry Basket