| Species : | Human | 
                                
                                    | Source : | Yeast | 
                                
                                    | Tag : | His | 
                                
                                    | Protein Length : | 20-381 aa | 
                                
                                    | Description : | Might be responsible for some of the Extracellular domain antioxidant defense properties of selenium or might be involved in the transport of selenium. May supply selenium to tissues such as brain and testis. | 
                                
                                    | Form : | Tris-based buffer,50% glycerol | 
                                
                                    | Molecular Mass : | 42.6 kDa | 
                                
                                    | AA Sequence : | ESQDQSSLCKQPPAWSIRDQDPMLNSNGSVTVVALLQASSYLCILQASKLEDLRVKLKKEGYSNISYIVVNHQGISSRLKYTHLKNKVSEHIPVYQQEENQTDVWTLLNGSKDDFLIYDRCGRLVYHLGLPFSFLTFPYVEEAIKIAYCEKKCGNCSLTTLKDEDFCKRVSLATVDKTVETPSPHYHHEHHHNHGHQHLGSSELSENQQPGAPNAPTHPAPPGLHHHHKHKGQHRQGHPENRDMPASEDLQDLQKKLCRKRCINQLLCKLPTDSELAPRSSCCHCRHLIFEKTGSAITSQCKENLPSLCSSQGLRAEENITESCQSRLPPAASQISQQLIPTEASASSRSKNQAKKSESPSN | 
                                
                                    | Purity : | > 90% as determined by SDS-PAGE. | 
                                
                                    | Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. | 
                                
                                    | Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. | 
                                
                                    | Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |