Recombinant Human SEPP1 protein, His-tagged
Cat.No. : | SEPP1-3478H |
Product Overview : | Recombinant Human SEPP1 protein(P49908)(20-381aa(U59S,U300S,U318S,U330S,U345S,U352S,U367S,U369S,U376S,U378S)), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 20-381aa(U59S,U300S,U318S,U330S,U345S,U352S,U367S,U369S,U376S,U378S) |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 44.6 kDa |
AA Sequence : | ESQDQSSLCKQPPAWSIRDQDPMLNSNGSVTVVALLQASSYLCILQASKLEDLRVKLKKEGYSNISYIVVNHQGISSRLKYTHLKNKVSEHIPVYQQEENQTDVWTLLNGSKDDFLIYDRCGRLVYHLGLPFSFLTFPYVEEAIKIAYCEKKCGNCSLTTLKDEDFCKRVSLATVDKTVETPSPHYHHEHHHNHGHQHLGSSELSENQQPGAPNAPTHPAPPGLHHHHKHKGQHRQGHPENRDMPASEDLQDLQKKLCRKRCINQLLCKLPTDSELAPRSSCCHCRHLIFEKTGSAITSQCKENLPSLCSSQGLRAEENITESCQSRLPPAASQISQQLIPTEASASSRSKNQAKKSESPSN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
Gene Name | SEPP1 selenoprotein P, plasma, 1 [ Homo sapiens ] |
Official Symbol | SEPP1 |
Synonyms | SEPP1; selenoprotein P, plasma, 1; selenoprotein P; SeP; SELP; |
Gene ID | 6414 |
mRNA Refseq | NM_001085486 |
Protein Refseq | NP_001078955 |
MIM | 601484 |
UniProt ID | P49908 |
◆ Recombinant Proteins | ||
SEPP1-4980R | Recombinant Rat SEPP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SEPP1-802H | Recombinant Human SEPP1 Protein (20-381 aa), His-tagged | +Inquiry |
SEPP1-801B | Recombinant Bovine SEPP1 Protein (20-402 aa), GST-tagged | +Inquiry |
SEPP1-14888M | Recombinant Mouse SEPP1 Protein | +Inquiry |
SEPP1-3478H | Recombinant Human SEPP1 protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SEPP1 Products
Required fields are marked with *
My Review for All SEPP1 Products
Required fields are marked with *