Recombinant Human SIRT4

Cat.No. : SIRT4-30846TH
Product Overview : Recombinant full length Human SIRT4 with an N terminal proprietary tag; predicted MWt 62 kDa inclusive of tag;
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : Non
Protein Length : 314 amino acids
Description : This gene encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined; however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class IV of the sirtuin family.
Molecular Weight : 62.000kDa inclusive of tags
Tissue specificity : Detected in vascular smooth muscle and striated muscle. Detected in insulin-producing beta-cells in pancreas islets of Langerhans (at protein level). Widely expressed. Weakly expressed in leukocytes and fetal thymus.
Form : Liquid
Purity : by SDS-PAGE
Storage buffer : Preservative: NoneConstituents: 25% Glycerol, 50mM Tris HCl, 150mM Sodium chloride, 10mM Glutathione, 0.25mM DTT, 0.1mM EDTA, 0.1mM PMSF, pH 7.5
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MKMSFALTFRSAKGRWIANPSQPCSKASIGLFVPASPPLDPEKVKELQRFITLSKRLLVMTGAGISTESGIPDYRSEKVGLYARTDRRPIQHGDFVRSAPIRQRYWARNFVGWPQFSSHQPNPAHWALSTWEKLGKLYWLVTQNVDALHTKAGSRRLTELHGCMDRVLCLDCGEQTPRGVLQERFQVLNPTWSAEAHGLAPDGDVFLSEEQVRSFQVPTCVQCGGHLKPDVVFFGDTVNPDKVDFVHKRVKEADSLLVVGSSLQVYSGYRFILTAWEKKLPIAILNIGPTRSDDLACLKLNSRCGELLPLIDPC
Sequence Similarities : Belongs to the sirtuin family.Contains 1 deacetylase sirtuin-type domain.
Gene Name SIRT4 sirtuin 4 [ Homo sapiens ]
Official Symbol SIRT4
Synonyms SIRT4; sirtuin 4; sirtuin (silent mating type information regulation 2 homolog) 4 (S. cerevisiae) , sirtuin (silent mating type information regulation 2, S. cerevisiae, homolog) 4; NAD-dependent ADP-ribosyltransferase sirtuin-4; SIR2L4;
Gene ID 23409
mRNA Refseq NM_012240
Protein Refseq NP_036372
MIM 604482
Uniprot ID Q9Y6E7
Chromosome Location 12q24.31
Pathway Signaling events mediated by HDAC Class I, organism-specific biosystem;
Function NAD+ ADP-ribosyltransferase activity; NAD+ ADP-ribosyltransferase activity; NAD+ binding; NOT NAD-dependent protein deacetylase activity; metal ion binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SIRT4 Products

Required fields are marked with *

My Review for All SIRT4 Products

Required fields are marked with *

0
cart-icon