Recombinant Human SSX2

Cat.No. : SSX2-31172TH
Product Overview : Recombinant full length Human SSX2 isoform 2 with N terminal proprietary tag; Predicted MW 50.64 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 223 amino acids
Description : The product of this gene belongs to the family of highly homologous synovial sarcoma X (SSX) breakpoint proteins. These proteins may function as transcriptional repressors. They are also capable of eliciting spontaneously humoral and cellular immune responses in cancer patients, and are potentially useful targets in cancer vaccine-based immunotherapy. SSX1, SSX2 and SSX4 genes have been involved in the t(X;18) translocation characteristically found in all synovial sarcomas. This translocation results in the fusion of the synovial sarcoma translocation gene on chromosome 18 to one of the SSX genes on chromosome X. The encoded hybrid proteins are probably responsible for transforming activity. Two transcript variants encoding distinct isoforms have been identified for this gene.
Molecular Weight : 50.640kDa inclusive of tags
Tissue specificity : Expressed at high level in the testis. Expressed at low level in thyroid. Not detected in tonsil, colon, lung, spleen, prostate, kidney, striated and smooth muscles. Detected in rhabdomyosarcoma and fibrosarcoma cell lines. Not detected in mesenchymal and
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MNGDDAFARRPTVGAQIPEKIQKAFDDIAKYFSKEEWEKM KASEKIFYVYMKRKYEAMTKLGFKATLPPFMCNKRAEDFQ GNDLDNDPNRGNQVERPQMTFGRLQGISPKIMPKKPAEEG NDSEEVPEASGPQNDGKELCPPGKPTTSEKIHERSGNREA QEKEERRGTAHRWSSQNTHNIGRFSLSTSMGAVHGTPKTI THNRDPKGGNMPGPTDCVRENSW
Sequence Similarities : Belongs to the SSX family.Contains 1 KRAB-related domain.
Gene Name SSX2 synovial sarcoma, X breakpoint 2 [ Homo sapiens ]
Official Symbol SSX2
Synonyms SSX2; synovial sarcoma, X breakpoint 2; SSX; protein SSX2; cancer/testis antigen family 5; member 2a; CT5.2a; HD21; HOM MEL 40; MGC3884; MGC15364; MGC119055; sarcoma; synovial; X chromosome related 2; synovial sarcoma; X breakpoint 2; isoform b; X breakpo
Gene ID 6757
mRNA Refseq NM_003147
Protein Refseq NP_003138
MIM 300192
Uniprot ID Q16385
Chromosome Location Xp11.22
Pathway Transcriptional misregulation in cancers, organism-specific biosystem; Transcriptional misregulation in cancers, conserved biosystem;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SSX2 Products

Required fields are marked with *

My Review for All SSX2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon