Recombinant Human TLR9 protein
Cat.No. : | TLR9-452H |
Product Overview : | Recombinant Human TLR9 was expressed in Wheat Germ. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Description : | The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural andfunctional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This gene is preferentially expressed in immune cell rich tissues, such as spleen, lymph node, bone marrow and peripheral blood leukocytes. Studies in mice and human indicate that this receptor mediates cellular response to unmethylatedCpG dinucleotides in bacterial DNA to mount an innate immune response. |
Form : | 25 mM Tris-HCl of pH8.0 containing 2% glycerol. |
Molecular Mass : | 113.52 kDa |
AA Sequence : | MGFCRSALHPLSLLVQAIMLAMTLALGTLPAFLPCELQPHGLVNCNWLFLKSVPHFSMAAPRGNVTSLSLSSNRI HHLHDSDFAHLPSLRHLNLKWNCPPVGLSPMHFPCHMTIEPSTFLAVPTLEELNLSYNNIMTVPALPKSLISLSL SHTNILMLDSASLAGLHALRFLFMDGNCYYKNPCRQALEVAPGALLGLGNLTHLSLKYNNLTVVPRNLPSSLEYL LLSYNRIVKLAPEDLANLTALRVLDVGGNCRRCDHAPNPCMECPRHFPQLHPDTFSHLSRLEGLVLKDSSLSWLN ASWFRGLGNLRVLDLSENFLYKCITKTKAFQGLTQLRKLNLSFNYQKRVSFAHLSLAPSFGSLVALKELDMHGIF FRSLDETTLRPLARLPMLQTLRLQMNFINQAQLGIFRAFPGLRYVDLSDNRISGASELTATMGEADGGEKVWLQP GDLAPAPVDTPSSEDFRPNCSTLNFTLDLSRNNLVTVQPEMFAQLSHLQCLRLSHNCISQAVNGSQFLPLTGLQV LDLSHNKLDLYHEHSFTELPRLEALDLSYNSQPFGMQGVGHNFSFVAHLRTLRHLSLAHNNIHSQVSQQLCSTSL RALDFSGNALGHMWAEGDLYLHFFQGLSGLIWLDLSQNRLHTLLPQTLRNLPKSLQVLRLRDNYLAFFKWWSLHF LPKLEVLDLAGNQLKALTNGSLPAGTRLRRLDVSCNSISFVAPGFFSKAKELRELNLSANALKTVDHSWFGPLAS ALQILDVSANPLHCACGAAFMDFLLEVQAAVPGLPSRVKCGSPGQLQGLSIFAQDLRLCLDEALSWDCFALSLLA VALGLGVPMLHHLCGWDLWYCFHLCLAWLPWRGRQSGRDEDALPYDAFVVFDKTQSAVADWVYNELRGQLEECRG RWALRLCLEERDWLPGKTLFENLWASVYGSRKTLFVLAHTDRVSGLLRASFLLAQQRLLEDRKDVVVLVILSPDG RRSRYVRLRQRLCRQSVLLWPHQPSGQRSFWAQLGMALTRDNHHFYNRNFCQGPTAE |
Applications : | Antibody Production;Functional Study: Recommended usage only, not validated yet;Compound Screening: Recommended usage only, not validated yet. |
Notes : | Heating may cause protein aggregation. Please do not heat this product before electrophoresis. Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Gene Name | TLR9 toll-like receptor 9 [ Homo sapiens ] |
Official Symbol | TLR9 |
Synonyms | TLR9; toll-like receptor 9; CD289; |
Gene ID | 54106 |
mRNA Refseq | NM_017442 |
Protein Refseq | NP_059138 |
MIM | 605474 |
UniProt ID | Q9NR96 |
Chromosome Location | 3p21.3 |
Pathway | African trypanosomiasis, organism-specific biosystem; African trypanosomiasis, conserved biosystem; Chagas disease (American trypanosomiasis), organism-specific biosystem; Chagas disease (American trypanosomiasis), conserved biosystem; Herpes simplex infection, organism-specific biosystem; Herpes simplex infection, conserved biosystem; IRS-mediated signalling, organism-specific biosystem; |
Function | interleukin-1 receptor binding; receptor activity; siRNA binding; |
◆ Recombinant Proteins | ||
TLR9-422R | Recombinant Rabbit TLR9 Protein, His-tagged | +Inquiry |
TLR9-695H | Recombinant Human TLR9 protein, His-tagged | +Inquiry |
Tlr9-697R | Recombinant Rat Tlr9 protein, His & T7-tagged | +Inquiry |
TLR9-16831M | Recombinant Mouse TLR9 Protein | +Inquiry |
Tlr9-696M | Recombinant Mouse Tlr9 protein, His & GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TLR9-1042HCL | Recombinant Human TLR9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TLR9 Products
Required fields are marked with *
My Review for All TLR9 Products
Required fields are marked with *
0
Inquiry Basket