Recombinant Human TRPS1 protein, His-tagged
Cat.No. : | TRPS1-3439H |
Product Overview : | Recombinant Human TRPS1 protein(NP_001269831)(1158-1281 aa), fused to His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Protein Length : | 1158-1281 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.). 5 % trehalose and 5 % mannitol are added as protectants before lyophilization. |
AA Sequence : | SDNDIPLDLAIKHSRPGPTANGASKEKTKAPPNVKNEGPLNVVKTEKVDRSTQDELSTKCVHCGIVFLDEVMYALHMSCHGDSGPFQCSICQHLCTDKYDFTTHIQRGLHRNNAQVEKNGKPKE |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details). |
Gene Name | TRPS1 transcriptional repressor GATA binding 1 [ Homo sapiens (human) ] |
Official Symbol | TRPS1 |
Synonyms | GC79; LGCR |
Gene ID | 7227 |
mRNA Refseq | NM_001282902.3 |
Protein Refseq | NP_001269831 |
MIM | 604386 |
UniProt ID | Q9UHF7 |
◆ Recombinant Proteins | ||
TRPS1-301463H | Recombinant Human TRPS1 protein, GST-tagged | +Inquiry |
TRPS1-3438H | Recombinant Human TRPS1 protein, His-tagged | +Inquiry |
TRPS1-839HCL | Recombinant Human TRPS1 lysate, MYC/DDK-tagged | +Inquiry |
TRPS1-3193H | Recombinant Human TRPS1 protein, His-tagged | +Inquiry |
TRPS1-3440H | Recombinant Human TRPS1 protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All TRPS1 Products
Required fields are marked with *
My Review for All TRPS1 Products
Required fields are marked with *
0
Inquiry Basket