Recombinant Human WHSC2, His-tagged
Cat.No. : | WHSC2-30860TH |
Product Overview : | Recombinant full length Human WHSC2 (amino acids 1-539) with an N terminal His tag; 569 amino acids with tag, Predicted MWt 60.6kDa, |
- Specification
- Gene Information
- Related Products
Description : | This gene is expressed ubiquitously with higher levels in fetal than in adult tissues. It encodes a protein sharing 93% sequence identity with the mouse protein. Wolf-Hirschhorn syndrome (WHS) is a malformation syndrome associated with a hemizygous deletion of the distal short arm of chromosome 4. This gene is mapped to the 165 kb WHS critical region, and may play a role in the phenotype of the WHS or Pitt-Rogers-Danks syndrome. The encoded protein is found to be capable of reacting with HLA-A2-restricted and tumor-specific cytotoxic T lymphocytes, suggesting a target for use in specific immunotherapy for a large number of cancer patients. This protein has also been shown to be a member of the NELF (negative elongation factor) protein complex that participates in the regulation of RNA polymerase II transcription elongation. |
Protein length : | 539 amino acids |
Conjugation : | HIS |
Molecular Weight : | 60.600kDa inclusive of tags |
Source : | E. coli |
Form : | Liquid |
Purity : | by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 1.17% Sodium chloride, 0.08% DTT, 0.03% EDTA, 20% Glycerol |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMPGQRRALSPKMASMRESDT GLWLHNKLGATDELWAPPSIASLLTAAVIDNIRLCFHGLS SAVKLKLLLGTLHLPRRTVDEMKGALMEIIQLASLDSDPW VLMVADILKSFPDTGSLNLELEEQNPNVQDILGELREKVG ECEASAMLPLECQYLNKNALTTLAGPLTPPVKHFQLKRKP KSATLRAELLQKSTETAQQLKRSAGVPFHAKGRGLLRKMD TTTPLKGIPKQAPFRSPTAPSVFSPTGNRTPIPPSRTLLR KERGVKLLDISELDMVGAGREAKRRRKTLDAEVVEKPAKE ETVVENATPDYAAGLVSTQKLGSLNNEPALPSTSYLPSTP SVVPASSYIPSSETPPAPSSREASRPPEEPSAPSPTLPAQ FKQRAPMYNSGLSPATPTPAAPTSPLTPTTPPAVAPTTQT PPVAMVAPQTQAPAQQQPKKNLSLTREQMFAAQEMFKTAN KVTRPEKALILGFMAGSRENPCQEQGDVIQIKLSEHTEDL PKADGQGSTTMLVDTVFEMNYATGQWTRFKKYKPMTNVS |
Gene Name : | WHSC2 Wolf-Hirschhorn syndrome candidate 2 [ Homo sapiens ] |
Official Symbol : | WHSC2 |
Synonyms : | WHSC2; Wolf-Hirschhorn syndrome candidate 2; negative elongation factor A; NELF A; |
Gene ID : | 7469 |
mRNA Refseq : | NM_005663 |
Protein Refseq : | NP_005654 |
MIM : | 606026 |
Uniprot ID : | Q9H3P2 |
Chromosome Location : | 4p16.3 |
Pathway : | Abortive elongation of HIV-1 transcript in the absence of Tat, organism-specific biosystem; Formation and Maturation of mRNA Transcript, organism-specific biosystem; Formation of HIV-1 elongation complex containing HIV-1 Tat, organism-specific biosystem; Formation of HIV-1 elongation complex in the absence of HIV-1 Tat, organism-specific biosystem; Formation of RNA Pol II elongation complex, organism-specific biosystem; |
Products Types
◆ Recombinant Protein | ||
WHSC2-10179M | Recombinant Mouse WHSC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
WHSC2-3015H | Recombinant Human Wolf-Hirschhorn Syndrome Candidate 2, T7-tagged | +Inquiry |
WHSC2-3397H | Recombinant Human Wolf-Hirschhorn Syndrome Candidate 2, His-tagged | +Inquiry |
WHSC2-18547M | Recombinant Mouse WHSC2 Protein | +Inquiry |
◆ Lysates | ||
WHSC2-1932HCL | Recombinant Human WHSC2 cell lysate | +Inquiry |
Related Gene
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.
Inquiry
0
Inquiry Basket